GSSGSSGSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGSGPSSG
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1x4w:A | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 7.75e-44 | |
2 | 1wfl:A | 74 | 56 | 0.3582 | 0.3243 | 0.4286 | 2.76e-11 | |
3 | 1wg2:A | 64 | 55 | 0.3731 | 0.3906 | 0.4545 | 4.55e-11 | |
4 | 1wfp:A | 74 | 56 | 0.3731 | 0.3378 | 0.4464 | 1.01e-10 | |
5 | 1wfh:A | 64 | 51 | 0.3881 | 0.4062 | 0.5098 | 1.54e-09 | |
6 | 1wff:A | 85 | 87 | 0.4925 | 0.3882 | 0.3793 | 1.08e-07 | |
7 | 1x4v:A | 63 | 69 | 0.4030 | 0.4286 | 0.3913 | 0.001 | |
8 | 1wfk:A | 88 | 26 | 0.1642 | 0.1250 | 0.4231 | 0.36 | |
9 | 2d8y:A | 91 | 43 | 0.1940 | 0.1429 | 0.3023 | 0.44 | |
10 | 2d9m:A | 69 | 69 | 0.3284 | 0.3188 | 0.3188 | 1.5 | |
11 | 2dj8:A | 60 | 67 | 0.3582 | 0.4000 | 0.3582 | 2.5 | |
12 | 5dka:A | 96 | 24 | 0.1642 | 0.1146 | 0.4583 | 3.0 | 5dka:B, 8gbq:B, 8gcb:B |
13 | 2dlk:A | 79 | 79 | 0.4030 | 0.3418 | 0.3418 | 5.3 | |
14 | 3ef1:A | 372 | 32 | 0.2090 | 0.0376 | 0.4375 | 6.1 | 3ef0:A, 4xpz:A, 4xq0:A |
15 | 4njm:A | 303 | 25 | 0.1642 | 0.0363 | 0.4400 | 6.7 | 4njm:B, 4njo:A |
16 | 2csz:A | 76 | 78 | 0.3881 | 0.3421 | 0.3333 | 7.0 | |
17 | 2ect:A | 78 | 55 | 0.2836 | 0.2436 | 0.3455 | 7.4 |