BioLiP

>protein
GSSGSSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSG
PSSG

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1x4u:A	84	84	1.0000	1.0000	1.0000	2.56e-54
2	6w9n:A	78	63	0.2500	0.2692	0.3333	4.73e-07
3	1wfk:A	88	84	0.3452	0.3295	0.3452	9.05e-07
4	3t7l:A	74	70	0.2738	0.3108	0.3286	1.50e-05
5	2ct2:A	88	88	0.3452	0.3295	0.3295	9.43e-05	5fey:A, 5fey:B
6	1vfy:A	67	59	0.2381	0.2985	0.3390	1.95e-04
7	1joc:A	123	63	0.2619	0.1789	0.3492	2.24e-04	1hyi:A, 1hyj:A, 1joc:B
8	2yqm:A	89	88	0.3214	0.3034	0.3068	0.001	2yw8:A
9	4avx:A	218	67	0.2381	0.0917	0.2985	0.032	3zyq:A
10	1dvp:A	217	62	0.2024	0.0783	0.2742	0.089
11	5koa:B	246	22	0.1071	0.0366	0.4091	0.91
12	8adl:B	801	79	0.2262	0.0237	0.2405	2.2	8adl:G, 8adl:O, 8adl:J
13	2ct0:A	74	90	0.3690	0.4189	0.3444	2.4
14	2rpz:A	192	14	0.1310	0.0573	0.7857	5.9
15	4r3u:A	557	36	0.1667	0.0251	0.3889	6.0	4r3u:B
16	2pv0:B	347	46	0.1905	0.0461	0.3478	6.0	2pv0:A, 2pv0:C, 2pvc:B, 2pvc:A, 2pvc:C
17	3vth:A	753	78	0.2619	0.0292	0.2821	6.7	3vth:B, 3vti:A, 3vti:B
18	7xyz:B	456	48	0.1905	0.0351	0.3333	8.6	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D
19	4txa:A	367	32	0.1071	0.0245	0.2812	9.7	5f5f:A, 5f5f:G, 5f5f:C, 5f5f:E, 5f5h:A, 5f5h:B, 4qi2:A, 4qi2:B, 4qi2:C, 4qi2:D, 4qik:A, 4qik:B, 4qil:B, 4qil:A, 6tqa:A, 6tqa:B, 6tqa:C, 6tqa:D, 6tqb:A, 4ywq:A, 4zld:A

[Back]