BioLiP

>protein
GSSGSSGQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQSGPSSG

The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2e72:A	49	49	1.0000	1.0000	1.0000	3.07e-31
2	2emb:A	44	49	0.4082	0.4545	0.4082	0.008
3	2epr:A	48	49	0.4286	0.4375	0.4286	0.12
4	2ena:A	46	49	0.4286	0.4565	0.4286	0.13
5	5ijl:A	943	33	0.2857	0.0148	0.4242	0.20
6	8ppt:B	1191	33	0.2857	0.0118	0.4242	0.21	8ppu:B, 8ppv:B, 6t8h:B
7	2en4:A	46	49	0.4082	0.4348	0.4082	0.27
8	2rsj:A	92	29	0.2245	0.1196	0.3793	0.34	2els:A, 2rut:A, 2rv6:A
9	2eou:A	44	49	0.4082	0.4545	0.4082	0.67
10	2ivk:B	213	20	0.2245	0.0516	0.5500	0.75	2ivk:A, 2ivk:D, 2ivk:C, 1ouo:A, 1oup:B, 1oup:A
11	1x4s:A	59	63	0.4898	0.4068	0.3810	0.86
12	2km0:A	74	22	0.2449	0.1622	0.5455	1.3	3dso:A, 2lel:A, 3n7d:A, 3n7d:B, 3n7e:A, 3n7e:B
13	2pu3:A	207	20	0.2245	0.0531	0.5500	1.8
14	2eoy:A	46	52	0.4082	0.4348	0.3846	2.4
15	2wbt:A	125	21	0.1633	0.0640	0.3810	2.6	2wbt:B
16	4lqx:B	309	22	0.1837	0.0291	0.4091	3.4	4lqx:A
17	5apo:y	217	19	0.2041	0.0461	0.5263	4.3	5apn:y, 6rzz:u
18	4nl8:A	549	22	0.1837	0.0164	0.4091	4.6
19	4nl8:E	571	22	0.1837	0.0158	0.4091	4.6	4nl8:B
20	6dgd:A	704	22	0.1837	0.0128	0.4091	5.3	6dgd:B, 4nl4:H
21	8c29:S	211	26	0.2041	0.0474	0.3846	5.3	8c29:s
22	2emc:A	46	49	0.3878	0.4130	0.3878	7.2
23	2con:A	79	36	0.2857	0.1772	0.3889	7.2
24	8uxw:A	400	23	0.1224	0.0150	0.2609	7.4	8e9b:A, 8uxx:A, 6w17:A
25	8fjl:D	1138	19	0.1633	0.0070	0.4211	8.3	8fjk:E, 8fjk:G, 8fjk:I, 8fjk:K, 8fjl:E, 8fjl:G, 8fjl:I, 8fjl:K, 6m99:C
26	3f2b:A	994	23	0.2245	0.0111	0.4783	9.4	3f2c:A, 3f2d:A
27	2co8:A	82	82	0.5102	0.3049	0.3049	9.5

[Back]