GSSGSSGIHHLPPVKAPLQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPVS
GPSSG
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wff:A | 85 | 85 | 1.0000 | 1.0000 | 1.0000 | 1.84e-59 | |
2 | 1wfh:A | 64 | 58 | 0.3765 | 0.5000 | 0.5517 | 6.89e-14 | |
3 | 1wfl:A | 74 | 71 | 0.4235 | 0.4865 | 0.5070 | 7.63e-14 | |
4 | 1wfp:A | 74 | 70 | 0.3647 | 0.4189 | 0.4429 | 1.13e-13 | |
5 | 1wg2:A | 64 | 58 | 0.3294 | 0.4375 | 0.4828 | 2.37e-11 | |
6 | 1x4w:A | 67 | 67 | 0.3059 | 0.3881 | 0.3881 | 7.88e-07 | |
7 | 1wys:A | 75 | 88 | 0.3647 | 0.4133 | 0.3523 | 0.001 | |
8 | 1wfe:A | 86 | 41 | 0.1765 | 0.1744 | 0.3659 | 0.20 | |
9 | 5ij4:A | 49 | 39 | 0.1765 | 0.3061 | 0.3846 | 0.53 | |
10 | 7t27:A | 140 | 40 | 0.1765 | 0.1071 | 0.3750 | 1.1 | |
11 | 1x4v:A | 63 | 87 | 0.3294 | 0.4444 | 0.3218 | 1.3 | |
12 | 7f0r:D | 1339 | 57 | 0.1882 | 0.0119 | 0.2807 | 4.3 | 7vf9:D, 7xl3:D, 7xl4:D, 7xya:D, 7xyb:D |
13 | 6tf9:UP1 | 569 | 53 | 0.1765 | 0.0264 | 0.2830 | 5.0 | |
14 | 6p24:B | 793 | 29 | 0.1059 | 0.0113 | 0.3103 | 5.1 | |
15 | 2ea5:A | 68 | 87 | 0.2824 | 0.3529 | 0.2759 | 7.3 |