GSSGSSGALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMN
SGPSSG
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ct7:A | 86 | 86 | 1.0000 | 1.0000 | 1.0000 | 3.25e-61 | |
2 | 6sc6:A | 365 | 74 | 0.8488 | 0.2000 | 0.9865 | 7.67e-50 | 5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C |
3 | 1wfe:A | 86 | 64 | 0.2326 | 0.2326 | 0.3125 | 0.024 | |
4 | 7y7l:A | 45 | 34 | 0.1512 | 0.2889 | 0.3824 | 0.034 | |
5 | 8eb0:A | 255 | 51 | 0.1744 | 0.0588 | 0.2941 | 0.52 | 7m4m:A, 7m4m:B, 7m4n:A, 7m4n:B, 7m4o:A |
6 | 1x4v:A | 63 | 86 | 0.2558 | 0.3492 | 0.2558 | 0.67 | |
7 | 1weo:A | 93 | 101 | 0.3372 | 0.3118 | 0.2871 | 0.69 | |
8 | 2ecn:A | 70 | 39 | 0.1628 | 0.2000 | 0.3590 | 0.77 | 5xek:A |
9 | 2ecj:A | 58 | 71 | 0.2674 | 0.3966 | 0.3239 | 1.2 | |
10 | 8aaf:e | 1527 | 58 | 0.1860 | 0.0105 | 0.2759 | 1.4 | 8agt:e, 8agu:e, 8agv:e, 8agw:e, 8agx:e, 8agz:e |
11 | 2yur:A | 74 | 62 | 0.2209 | 0.2568 | 0.3065 | 1.5 | |
12 | 2d8q:A | 70 | 88 | 0.3023 | 0.3714 | 0.2955 | 3.6 | 2dan:A |
13 | 7mq8:NJ | 827 | 33 | 0.1047 | 0.0109 | 0.2727 | 3.7 | 7mq8:NK, 7mq9:NJ, 7mq9:NK |
14 | 1x4s:A | 59 | 59 | 0.2326 | 0.3390 | 0.3390 | 4.5 | |
15 | 8a22:AL | 394 | 24 | 0.1395 | 0.0305 | 0.5000 | 9.2 | 8apn:AL, 8apo:AL |
16 | 8a22:AN | 420 | 24 | 0.1395 | 0.0286 | 0.5000 | 9.2 | 8a22:AM, 8apn:AN, 8apn:AM, 8apo:AN, 8apo:AM |
17 | 8kdb:A | 2117 | 35 | 0.1279 | 0.0052 | 0.3143 | 9.8 | 8kdc:A |