BioLiP

>protein
GSRRASVGSEFTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADA

The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6qxz:A	79	79	1.0000	1.0000	1.0000	3.92e-53
2	2l7p:A	100	91	1.0000	0.7900	0.8681	8.77e-50	5yvx:A
3	5ix1:A	414	53	0.2532	0.0483	0.3774	9.90e-09
4	6o1e:A	431	48	0.2278	0.0418	0.3750	6.01e-08	5ix1:B, 5ix2:A, 5ix2:B, 4qq4:A, 4qq4:B, 5svi:A, 5svi:B, 5svx:A, 5svy:A
5	6o5w:A	57	57	0.2658	0.3684	0.3684	8.28e-08
6	7k7t:A	390	52	0.2405	0.0487	0.3654	1.12e-07	7k7t:B
7	4o62:B	57	52	0.2152	0.2982	0.3269	5.10e-07	4o62:A, 4o62:C, 4z0o:A, 4z0r:B, 4z0r:A, 4z0r:C
8	5ofb:B	541	44	0.1646	0.0240	0.2955	0.068	5of9:A, 5of9:B, 5ofa:B, 5ofa:A, 5ofb:A
9	7vgb:A	681	34	0.1266	0.0147	0.2941	2.3	7vgb:B, 7vgc:A
10	4x2h:A	192	32	0.1139	0.0469	0.2812	3.1	4x2o:A
11	5kkw:A	237	43	0.1519	0.0506	0.2791	3.9
12	7s9w:B	529	11	0.1013	0.0151	0.7273	5.0
13	6nrz:A	517	31	0.1266	0.0193	0.3226	8.4	6nrz:B, 6ns0:A, 6ns0:B, 6o3f:A, 6o3f:B
14	2bwr:A	401	28	0.1519	0.0299	0.4286	8.9	2bwm:A, 2bwr:B, 2c25:A, 2c25:B, 2c4d:A, 4up4:A, 4up4:B
15	2k16:A	75	38	0.1392	0.1467	0.2895	9.3	5c13:A, 5c13:C, 5c13:E, 5c13:G, 2k17:A, 5wxg:A, 5wxh:C, 5wxh:A, 5xmy:A, 5xmy:C

[Back]