GSPGENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGEIE
KFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRD
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7nm2:A | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 2.44e-116 | 7nm4:A, 7nm5:A, 6ux8:A, 6zpr:A, 6zz1:A, 6zz1:B |
2 | 4fkc:A | 370 | 95 | 0.1720 | 0.0730 | 0.2842 | 0.16 | 4rgz:A, 4rgz:N, 4rgz:1, 4rgz:e |
3 | 5cd6:A | 575 | 54 | 0.0892 | 0.0243 | 0.2593 | 4.8 | |
4 | 4xyj:A | 768 | 63 | 0.1274 | 0.0260 | 0.3175 | 7.5 | 4rh3:A, 4rh3:B, 4rh3:C, 4rh3:D, 4u1r:A, 4u1r:B, 4u1r:C, 4u1r:D, 4wl0:A, 4wl0:B, 4wl0:C, 4wl0:D, 4xyj:B, 4xyj:C, 4xyj:D, 4xyj:E, 4xyj:F, 4xyj:G, 4xyj:H, 4xyk:A, 4xyk:B, 4xyk:C, 4xyk:D, 4xz2:A, 4xz2:B, 4xz2:C, 4xz2:D |
5 | 4ar9:A | 392 | 44 | 0.0892 | 0.0357 | 0.3182 | 7.7 | 4ar8:A, 4ar8:B, 4ar9:B |
6 | 7tmv:A | 159 | 29 | 0.0892 | 0.0881 | 0.4828 | 7.8 | 7tmv:B |
7 | 8b9o:A | 143 | 57 | 0.1146 | 0.1259 | 0.3158 | 7.9 | |
8 | 2isa:A | 482 | 69 | 0.1338 | 0.0436 | 0.3043 | 8.2 | 2isa:B, 2isa:C, 2isa:D, 2isa:E, 2isa:F, 2isa:G, 2isa:H |