GSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSNKYYCNEHV
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jwo:A | 82 | 74 | 1.0000 | 0.8659 | 0.9595 | 5.73e-49 | 8t4r:A, 2v83:A, 2v83:B, 2v83:C, 2v85:A, 2v85:B, 2v86:B, 2v86:A, 2v87:A, 2v87:B, 2v88:A, 2v88:B, 2v89:B, 2v89:A |
2 | 8sm5:I | 138 | 30 | 0.1408 | 0.0725 | 0.3333 | 1.8 | |
3 | 2wh6:A | 157 | 30 | 0.1408 | 0.0637 | 0.3333 | 2.0 | 7p33:B, 7p33:D, 7p33:A, 7p33:E, 7p9w:A, 8sm5:A, 8sm5:C, 8sm5:G, 8sm5:E, 2v6q:A, 2xpx:A |
4 | 8ro0:A | 2231 | 44 | 0.1972 | 0.0063 | 0.3182 | 3.6 | 8ro1:A |
5 | 8fia:A | 1772 | 24 | 0.1408 | 0.0056 | 0.4167 | 3.6 | |
6 | 7lbe:C | 299 | 29 | 0.1831 | 0.0435 | 0.4483 | 3.8 | 7lbf:C, 7lbg:C |
7 | 6ndr:A | 188 | 24 | 0.1127 | 0.0426 | 0.3333 | 4.5 | 6ndr:B |
8 | 3oft:A | 396 | 24 | 0.0986 | 0.0177 | 0.2917 | 5.8 | 3oft:B, 3oft:C, 3ofu:A, 3ofu:B, 3ofu:C, 3ofu:D, 3ofu:E, 3ofu:F |
9 | 7c86:A | 296 | 52 | 0.2254 | 0.0541 | 0.3077 | 8.4 | 6csn:A, 6cso:A, 7e6x:A, 7e6y:A, 7e6z:A, 7e70:A, 7e71:A, 3ug9:A, 4yzi:A |