GSMIELEFHDVTFDPEVAYANFKRVHTTGLSYDHIRIFYIKGREIKTSLAKRSEWEVTLNLGGWKITVYNTNFPGNRNNP
VPDDGLTLHRLSGFLARYLLEKMLKVSEPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMFLGTFRFYPLAIGI
YKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTEVQSALTVVSSLGWKKTNVSAAARDFLAKFGIN
The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ijs:A | 232 | 231 | 0.9825 | 0.9655 | 0.9697 | 4.28e-166 | 4ijs:B, 4ijs:C, 4ijs:D, 3zla:A, 3zla:B, 3zla:C, 3zla:D, 3zla:E, 3zla:F, 3zla:G, 3zla:H |
2 | 4bhh:F | 232 | 230 | 0.4342 | 0.4267 | 0.4304 | 1.15e-66 | 4bhh:B, 4bhh:D, 4bhh:Z |
3 | 4j1j:C | 234 | 217 | 0.3991 | 0.3889 | 0.4194 | 6.86e-61 | 4j1g:A, 4j1g:D, 4j1g:C, 4j1g:B, 4j1j:A, 4j1j:B, 4j1j:D |
4 | 4jng:A | 226 | 218 | 0.3904 | 0.3938 | 0.4083 | 2.97e-57 | 4jng:B, 4jng:C, 4jng:D |
5 | 4oak:A | 190 | 73 | 0.1053 | 0.1263 | 0.3288 | 0.48 | 4mur:A, 4mur:B, 4mus:A, 4mus:B, 4mut:A, 4mut:B, 4oak:B |
6 | 4frx:B | 400 | 47 | 0.0746 | 0.0425 | 0.3617 | 0.85 | 4frx:A |
7 | 7w54:B | 518 | 40 | 0.0658 | 0.0290 | 0.3750 | 1.0 | 7w54:A |
8 | 8yo4:A | 442 | 74 | 0.0965 | 0.0498 | 0.2973 | 7.9 | 8ylu:A, 8ylu:B, 8yo4:B, 8yo7:A, 8yo7:B, 8yon:A, 8yon:B |
9 | 6mhm:B | 253 | 29 | 0.0526 | 0.0474 | 0.4138 | 9.1 | 6mhm:D |