BioLiP

>protein
GSMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDV

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7lt9:B	131	63	0.9545	0.4809	1.0000	1.09e-43	7d2s:B, 7d2t:B, 7d2t:D, 7d2u:B, 1nyp:A, 1u5s:B
2	7lt9:B	131	57	0.3030	0.1527	0.3509	0.001	7d2s:B, 7d2t:B, 7d2t:D, 7d2u:B, 1nyp:A, 1u5s:B
3	7qb0:A	127	60	0.3636	0.1890	0.4000	3.27e-11
4	7qb0:A	127	59	0.3636	0.1890	0.4068	8.58e-10
5	6u4m:A	65	57	0.3485	0.3538	0.4035	1.28e-10	6u4n:B
6	1x3h:A	80	58	0.3485	0.2875	0.3966	1.64e-10
7	2dar:A	90	61	0.3485	0.2556	0.3770	2.65e-09
8	2d8z:A	70	65	0.3485	0.3286	0.3538	2.41e-08
9	2dj7:A	80	73	0.3939	0.3250	0.3562	7.56e-08
10	3ixe:B	70	57	0.3636	0.3429	0.4211	2.96e-07
11	1v6g:A	81	34	0.2727	0.2222	0.5294	1.94e-06
12	1g47:A	70	67	0.3333	0.3143	0.3284	8.26e-06	2kbx:B
13	1x64:A	89	54	0.3333	0.2472	0.4074	8.30e-06
14	3f6q:B	72	47	0.2727	0.2500	0.3830	1.22e-05	4hi8:B, 4hi9:B
15	2cuq:A	80	59	0.2576	0.2125	0.2881	2.48e-05
16	1b8t:A	192	64	0.3788	0.1302	0.3906	3.49e-05	1ctl:A
17	2cur:A	69	62	0.2727	0.2609	0.2903	5.18e-05
18	6mif:A	79	57	0.3030	0.2532	0.3509	1.10e-04
19	1m3v:A	122	66	0.2879	0.1557	0.2879	4.63e-04
20	2l4z:A	121	60	0.2727	0.1488	0.3000	4.77e-04
21	6cme:A	154	61	0.2576	0.1104	0.2787	7.15e-04	6cme:B, 3mmk:A, 3mmk:B
22	2dfy:X	158	61	0.2727	0.1139	0.2951	7.47e-04	2dfy:C, 1rut:X
23	2dfy:X	158	52	0.2424	0.1013	0.3077	0.32	2dfy:C, 1rut:X
24	2d8x:A	70	61	0.3030	0.2857	0.3279	8.11e-04
25	2dlo:A	81	36	0.2121	0.1728	0.3889	0.001
26	1iml:A	76	61	0.3030	0.2632	0.3279	0.001
27	1cxx:A	59	55	0.2879	0.3220	0.3455	0.005	1ibi:A, 1qli:A
28	1wyh:A	72	48	0.2273	0.2083	0.3125	0.008
29	2cup:A	101	58	0.2727	0.1782	0.3103	0.011
30	1x61:A	72	44	0.2424	0.2222	0.3636	0.014
31	2cu8:A	76	47	0.2424	0.2105	0.3404	0.019
32	4kfz:B	148	64	0.2879	0.1284	0.2969	0.038	4kfz:A, 2xjy:A, 2xjz:A, 2xjz:B, 2xjz:C, 2xjz:D, 2xjz:E, 2ypa:C
33	4kfz:B	148	53	0.2424	0.1081	0.3019	1.3	4kfz:A, 2xjy:A, 2xjz:A, 2xjz:B, 2xjz:C, 2xjz:D, 2xjz:E, 2ypa:C
34	1x62:A	79	57	0.2424	0.2025	0.2807	0.042
35	1x4k:A	72	63	0.2424	0.2222	0.2540	0.057
36	2d8y:A	91	50	0.2273	0.1648	0.3000	0.061
37	2o13:A	58	40	0.2121	0.2414	0.3500	0.068
38	2egq:A	77	53	0.2576	0.2208	0.3208	0.15
39	2cor:A	79	53	0.2576	0.2152	0.3208	0.19
40	2xqn:T	125	55	0.2273	0.1200	0.2727	0.25	2iyb:E, 2iyb:F, 2iyb:G, 2iyb:H
41	2xqn:T	125	55	0.2121	0.1120	0.2545	0.43	2iyb:E, 2iyb:F, 2iyb:G, 2iyb:H
42	2mbv:A	96	52	0.2424	0.1667	0.3077	0.27
43	1ee8:A	266	38	0.2576	0.0639	0.4474	0.33	1ee8:B
44	1wig:A	73	34	0.1818	0.1644	0.3529	0.39
45	2lxd:A	123	53	0.2424	0.1301	0.3019	0.60	2l6y:B, 2l6z:C
46	2lzu:A	72	60	0.2576	0.2361	0.2833	1.1
47	3ebe:C	177	28	0.1667	0.0621	0.3929	1.2	3ebe:A, 3ebe:B, 3h15:A
48	6yxy:BX	133	63	0.3182	0.1579	0.3333	1.4	7aoi:BX, 6hiv:BX, 6hix:BX
49	7aih:Ax	167	62	0.2424	0.0958	0.2581	1.5	7am2:Ax, 7ane:Ax
50	7qep:M3	161	22	0.1667	0.0683	0.5000	3.3
51	3vu2:A	692	24	0.1515	0.0145	0.4167	3.5	7ml5:A, 3vu2:B
52	4jcj:C	150	64	0.2424	0.1067	0.2500	3.8	4jcj:A, 4jcj:B
53	1x4l:A	72	47	0.1818	0.1667	0.2553	4.0
54	7cyx:A	363	22	0.1667	0.0303	0.5000	4.1	7cyx:B
55	5clt:A	646	24	0.1667	0.0170	0.4583	4.2	5clt:B, 5clt:C, 5clw:A, 5clw:C, 5clw:B
56	1x63:A	82	60	0.2273	0.1829	0.2500	4.4
57	6gaw:B2	179	42	0.2273	0.0838	0.3571	5.1	5aj4:B2, 6gb2:B2, 7nqh:B2, 7nql:B2, 7nsh:B2, 7nsi:B2, 7nsj:B2, 8oin:BF, 8oiq:BF, 4v19:2, 6ydp:B2, 6ydw:B2
58	8twf:C	385	31	0.2121	0.0364	0.4516	5.9	8twf:D, 8twf:A, 8twf:B
59	6v8i:AE	387	13	0.1212	0.0207	0.6154	8.3	6v8i:CE, 6v8i:BE
60	6sw9:C	61	33	0.1818	0.1967	0.3636	9.4	6swc:C, 6swd:C, 7zag:C, 7zah:C, 7zai:C, 7zhg:C

[Back]