GSHSEADNYARELKREQEEIIRVPDTEAAEVAEILARYGIEPHEYGPVVNALRKKPQAWLDFMMKFELGLEK
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6iu4:A | 225 | 71 | 0.9583 | 0.3067 | 0.9718 | 3.66e-46 | 6iu3:A, 6iu5:A, 6iu5:D, 6iu5:B, 6iu5:C, 6iu5:E, 6iu5:H, 6iu5:F, 6iu5:I, 6iu6:A, 6iu6:D, 6iu6:B, 6iu6:C, 6iu6:E, 6iu6:H, 6iu6:F, 6iu6:I, 6iu8:A, 6iu8:B, 6iu8:C, 6iu8:D, 6iu8:E, 6iu8:F, 6iu8:H, 6iu8:I, 6iu9:A, 6iu9:D, 6iu9:B, 6iu9:C, 6iu9:E, 6iu9:H, 6iu9:F, 6iu9:I |
| 2 | 3keo:B | 207 | 30 | 0.2083 | 0.0725 | 0.5000 | 0.10 | 3keo:A, 3keq:A, 3keq:B, 3ket:A |
| 3 | 6kme:A | 284 | 34 | 0.1528 | 0.0387 | 0.3235 | 2.1 | 6kmd:A |
| 4 | 4v3p:Ls | 262 | 31 | 0.1528 | 0.0420 | 0.3548 | 2.7 | 4v7e:Cq |
| 5 | 7jj9:A | 461 | 22 | 0.1528 | 0.0239 | 0.5000 | 5.0 | 7jj8:B, 7jj8:A, 7jj8:C, 7jj8:D, 7jja:A, 7jjb:A |
| 6 | 2wys:B | 516 | 27 | 0.1528 | 0.0213 | 0.4074 | 7.2 | 2w5f:A, 2w5f:B, 2wys:A, 2wze:A, 2wze:B |
| 7 | 6xwl:C | 477 | 38 | 0.1250 | 0.0189 | 0.2368 | 7.6 | 6xwl:F, 6xwl:A, 6xwl:B, 6xwl:D, 6xwl:E, 6xyl:A, 6xyl:B, 6xyl:C, 6xyl:D, 6xyl:E, 6xyl:F, 6y21:D, 6y21:A, 6y21:B, 6z3s:D, 6z3s:A, 6z3s:B, 6zs7:D, 6zs7:A, 6zs7:B, 6zs7:C, 6zs7:E, 6zs7:F |
| 8 | 3m4e:C | 293 | 25 | 0.1111 | 0.0273 | 0.3200 | 7.7 | 3m4e:B, 3m4e:G, 3m4e:F, 3m4e:E, 6u49:A, 6u49:C, 6u49:B, 6u49:G, 6u49:D, 6u49:E, 6u49:F, 6u4p:A, 6u4p:B, 6u4p:C, 6u4p:D, 6u4p:E, 6u4p:F, 6u4p:G |
umich.edu