GSHMPKIVEVNYTWATPLSYNFNPNMIVYHHTVDNNMTPQKIDEIHKQRGWSGIGYHFYIRKDGTIYRGRPENAVGSHAP
GVNARAFGIASEGNFNEEYVTPQQMTSLIALSRYLMNKYNITDLKRHKDVRQTECPGNNFPFEEIKAKLNVK
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6srt:A | 152 | 152 | 1.0000 | 1.0000 | 1.0000 | 4.97e-115 | 6ssc:A |
2 | 7f5i:A | 153 | 128 | 0.3289 | 0.3268 | 0.3906 | 1.21e-26 | |
3 | 1lba:A | 146 | 108 | 0.2829 | 0.2945 | 0.3981 | 1.06e-20 | |
4 | 1oht:A | 173 | 155 | 0.3487 | 0.3064 | 0.3419 | 4.49e-17 | 7nsx:AAA, 7nsz:AAA, 7nt0:AAA, 7nt0:BBB |
5 | 6su5:A | 154 | 119 | 0.2697 | 0.2662 | 0.3445 | 3.85e-16 | |
6 | 6fhg:A | 156 | 138 | 0.3026 | 0.2949 | 0.3333 | 5.66e-14 | 6fhg:B |
7 | 4z8i:A | 224 | 160 | 0.3026 | 0.2054 | 0.2875 | 8.68e-14 | |
8 | 2cb3:C | 173 | 103 | 0.2368 | 0.2081 | 0.3495 | 7.89e-10 | 2cb3:A, 2cb3:B, 2cb3:D |
9 | 3cg9:A | 171 | 106 | 0.2237 | 0.1988 | 0.3208 | 8.50e-10 | 6a89:B, 6a89:A, 6a89:D, 3cg9:B, 3cxa:A, 3cxa:B, 7dy5:C, 5e0b:C, 4fnn:A, 4fnn:B, 4fnn:D, 4gf9:D, 4gf9:C, 3ng4:C, 3ng4:D, 3nno:D, 3nw3:D, 3o4k:A, 3o4k:C, 3o4k:D, 3ogx:C, 3ogx:A, 4opp:A, 4opp:B, 4opp:D, 4opp:C, 4orv:D, 4oug:C, 4oug:D, 4q8s:A, 4q8s:C, 4q8s:D, 4q9e:D, 3qv4:C, 3rt4:C, 3rt4:D, 3t2v:B, 3t2v:D, 3t39:D, 3tru:D, 3usx:B, 7xfw:C, 7xfx:C, 7xfy:C, 7xfy:D, 7xu8:A, 7xu8:B |
10 | 2f2l:X | 166 | 94 | 0.1908 | 0.1747 | 0.3085 | 2.27e-08 | |
11 | 2aph:A | 165 | 113 | 0.2303 | 0.2121 | 0.3097 | 3.50e-07 | 2aph:B, 1sk4:A, 1twq:A |
12 | 2eax:C | 164 | 93 | 0.1974 | 0.1829 | 0.3226 | 3.56e-06 | |
13 | 2xz4:A | 165 | 130 | 0.2500 | 0.2303 | 0.2923 | 3.80e-05 | |
14 | 2f2l:A | 167 | 67 | 0.1316 | 0.1198 | 0.2985 | 0.017 | |
15 | 6d50:B | 840 | 55 | 0.1184 | 0.0214 | 0.3273 | 2.8 | 6d50:A, 6nzg:A, 6nzg:B, 5uj6:A, 5uj6:B |
16 | 5lt9:B | 253 | 62 | 0.1118 | 0.0672 | 0.2742 | 3.7 | 5lt9:A, 5lto:A, 5lto:B |
17 | 7qep:D6 | 101 | 23 | 0.0658 | 0.0990 | 0.4348 | 4.5 | |
18 | 7pvn:B | 990 | 102 | 0.1513 | 0.0232 | 0.2255 | 7.4 | 7sol:C |
19 | 7sol:A | 1011 | 102 | 0.1513 | 0.0227 | 0.2255 | 7.9 | 7pvn:A |
20 | 7fbq:A | 234 | 26 | 0.0724 | 0.0470 | 0.4231 | 8.5 | 1k0n:A |
21 | 8iyb:A | 275 | 72 | 0.1316 | 0.0727 | 0.2778 | 9.1 | 8iyb:B, 8iyc:A, 8iyc:B |