BioLiP

>protein
GSATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENK
CPVPFCLNIKQK

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7xez:A	163	92	0.9891	0.5583	0.9891	1.54e-63	8e1d:A, 1f81:A, 2mzd:A, 7xfg:A
2	6fgs:A	130	90	0.9783	0.6923	1.0000	6.13e-63
3	6fgn:A	124	90	0.9783	0.7258	1.0000	3.49e-62
4	3io2:A	109	87	0.9457	0.7982	1.0000	2.27e-60	3p57:P
5	3t92:A	113	84	0.9130	0.7434	1.0000	2.61e-58
6	5hpd:A	158	87	0.8587	0.5000	0.9080	2.04e-53	2ka6:A, 2kje:A
7	5hp0:A	122	87	0.8587	0.6475	0.9080	2.06e-53
8	5hou:A	171	61	0.2391	0.1287	0.3607	0.025	2ka4:A, 1l3e:B, 1l8c:A, 7lvs:B, 2lww:A, 1p4q:B, 7qgs:A, 1r8u:B, 1u2n:A
9	1ea0:A	1452	31	0.1196	0.0076	0.3548	1.7	1ea0:B
10	6s6t:A	1472	31	0.1196	0.0075	0.3548	1.7	6s6s:A, 6s6s:B, 6s6s:C, 6s6s:D, 6s6t:B, 6s6t:C, 6s6t:D, 6s6u:A, 6s6u:B, 6s6u:C, 6s6u:D, 6s6u:E, 6s6u:F, 6s6x:A, 6s6x:B, 6s6x:C, 6s6x:D, 6s6x:E, 6s6x:F, 2vdc:A, 2vdc:B, 2vdc:C, 2vdc:D, 2vdc:E, 2vdc:F
11	3ntl:A	388	52	0.2174	0.0515	0.3846	2.9	3ntl:B
12	7t3u:A	2020	47	0.1413	0.0064	0.2766	6.3	7t3u:D
13	2fq1:A	279	34	0.1087	0.0358	0.2941	6.6
14	8s91:A	602	28	0.0978	0.0150	0.3214	6.8	7dp3:A, 8s91:B, 8s91:C, 8s94:A, 8s94:C, 8s94:B
15	7wi7:A	565	28	0.0978	0.0159	0.3214	7.8
16	8cvc:A	327	63	0.2065	0.0581	0.3016	7.9	8cv8:A, 8cv9:A, 8cva:A, 8cvb:A, 8cvd:A, 8cve:A, 8cvf:A, 8cvg:A, 8cvh:A

[Back]