GSATLGRLVRAWPRRAAVVNKADILDEWADYDTLVPDYPLEIVPFAEHPLFLAAEPHQRQRVLTGMWIGYNERVIATEQL
IAEPAFDLVMHGVFPGSDDPLIRKSVQQAIVDESFHTYMHMLAIDRTRELRKISERPPQPELVTYRRLRRVLADMPEQWE
RDIAVLVWGAVAETCINALLALLARDATIQPMHSLITTLHLRDETAHGSIVVEVVRELYARMNEQQRRALVRCLPIALEA
FAEQDLSALLLELNAAGIRGAEEIVGDLRLVRDFSGARKMVEQLGLDDAVDFDFPERPDWS
The query sequence (length=301) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jcd:A | 315 | 298 | 0.9668 | 0.9238 | 0.9765 | 0.0 | 3chh:A, 3chh:B, 3chi:A, 3chi:B, 3cht:A, 3cht:B, 3chu:A, 3chu:B, 2jcd:B |
2 | 5hyh:A | 287 | 300 | 0.3322 | 0.3484 | 0.3333 | 9.37e-45 | 5hyg:A |
3 | 4bmq:A | 300 | 97 | 0.0797 | 0.0800 | 0.2474 | 0.79 | 4bmo:A, 4bmp:A, 4bmr:A, 4bmr:B, 4bmt:A, 4bmt:B, 4bmu:A, 4bmu:B, 6qo7:A, 6qo7:B, 6qo8:A, 6qo8:B, 6qo9:A, 6qo9:B, 6qob:A, 6qob:B, 6tqv:A, 6tqv:B, 6tqw:A, 6tqw:B, 6tqy:A, 6tqy:B, 6tqz:A, 6tqz:B, 7z3d:A, 7z3e:A |
4 | 3td9:A | 350 | 96 | 0.0797 | 0.0686 | 0.2500 | 5.8 | |
5 | 4dr0:B | 291 | 43 | 0.0532 | 0.0550 | 0.3721 | 6.6 | 4dr0:A |
6 | 7d1b:A | 302 | 41 | 0.0465 | 0.0464 | 0.3415 | 8.3 |