BioLiP

>protein
GSADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCT
RHDCPVCLPLKNA

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5hou:A	171	92	0.9355	0.5088	0.9457	4.88e-53	2ka4:A, 1l3e:B, 1l8c:A, 7lvs:B, 2lww:A, 1p4q:B, 7qgs:A, 1r8u:B, 1u2n:A
2	6fgs:A	130	96	0.3333	0.2385	0.3229	0.002
3	6fgn:A	124	96	0.3333	0.2500	0.3229	0.002
4	7xez:A	163	96	0.3333	0.1902	0.3229	0.002	8e1d:A, 1f81:A, 2mzd:A, 7xfg:A
5	3t92:A	113	91	0.3226	0.2655	0.3297	0.002
6	3io2:A	109	89	0.3011	0.2569	0.3146	0.003	3p57:P
7	5hp0:A	122	93	0.3441	0.2623	0.3441	0.018
8	5hpd:A	158	93	0.3441	0.2025	0.3441	0.025	2ka6:A, 2kje:A
9	2k9h:A	57	35	0.1183	0.1930	0.3143	1.3
10	3e0n:B	251	50	0.1505	0.0558	0.2800	1.5	3dfl:A, 3e0p:B, 3e16:B, 3fvf:B, 3gyl:B
11	3vb9:B	462	48	0.1720	0.0346	0.3333	2.3	3vb9:D
12	8em4:A	3818	49	0.1935	0.0047	0.3673	3.7	8em4:B
13	3wgc:B	333	24	0.1075	0.0300	0.4167	5.8	3wgb:A, 3wgb:B, 3wgb:C, 3wgb:D, 3wgc:A, 3wgc:C, 3wgc:D
14	1m2v:A	705	52	0.1398	0.0184	0.2500	6.6
15	6zga:A	751	52	0.1398	0.0173	0.2500	6.7	4bzi:A, 4bzi:D, 4bzi:G, 6gni:A, 1m2o:A, 1m2o:C, 2qtv:A, 6zga:E
16	7pua:Cg	487	47	0.1720	0.0329	0.3404	6.8	6hiv:Cg, 6hiw:Cg, 6hiz:Cg, 7pub:Cg, 6sg9:Cg, 6sgb:Cg
17	8em7:A	4378	49	0.1935	0.0041	0.3673	7.4	8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B

[Back]