BioLiP

>protein
GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYHKNKP

The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1fu9:A	36	36	0.9722	0.9722	0.9722	2.92e-20	1jn7:A
2	2ena:A	46	37	0.3333	0.2609	0.3243	0.32
3	2emb:A	44	32	0.3056	0.2500	0.3438	0.41
4	7aih:Ay	142	19	0.2500	0.0634	0.4737	0.69	7ane:Ay
5	2el6:A	46	26	0.2500	0.1957	0.3462	1.5
6	5kd6:A	400	32	0.3333	0.0300	0.3750	1.9	5kcl:A, 5kcl:B, 5kcq:A, 5kcq:B, 5kcy:A, 5kcy:B, 5kd0:A, 5kd0:B, 5kd6:B, 5kda:A, 5kda:B
7	1fv5:A	36	31	0.2778	0.2778	0.3226	3.6	2l6z:B, 1y0j:B
8	8izt:A	123	27	0.3056	0.0894	0.4074	4.1
9	2emx:A	44	26	0.2500	0.2045	0.3462	4.1
10	2em9:A	46	26	0.2222	0.1739	0.3077	4.1
11	6ahd:1	1048	28	0.2778	0.0095	0.3571	5.2	7abg:u, 7abh:u, 7abi:u, 6ah0:1, 7b0i:C, 7b91:C, 7b9c:C, 8ch6:C, 7dvq:1, 6en4:C, 7evo:1, 6ff4:u, 6ff7:u, 8h6e:2G, 8h6j:2G, 8h6k:2G, 8h6l:2G, 8hk1:1, 8i0p:1, 8i0r:1, 8i0s:1, 8i0t:1, 8i0u:1, 7omf:C, 7onb:C, 7opi:C, 7q3l:A, 7q4o:A, 7q4p:A, 8qo9:B1, 7qtt:C, 6qx9:B1, 8qxd:B1, 8qzs:B1, 8r08:B1, 8r09:B1, 8r0a:B1, 8r0b:B1, 8rm5:B1, 7vpx:1, 6y50:u, 6y5q:u, 8y7e:1, 5z56:1, 5z57:1, 5z58:1, 5zya:C
12	7w02:A	1566	31	0.2500	0.0057	0.2903	6.2
13	2eml:A	46	26	0.1944	0.1522	0.2692	8.0
14	2eq4:A	46	26	0.2222	0.1739	0.3077	8.3
15	6pep:M	144	34	0.2778	0.0694	0.2941	9.1	6pep:N, 6pep:O, 6pep:P, 6pep:Q, 6pep:A, 6pep:B, 6pep:C, 6pep:D, 6pep:F, 6pep:G, 6pep:H, 6pep:I, 6pep:J, 6pep:K, 6pep:L
16	2ytf:A	46	26	0.2222	0.1739	0.3077	9.5	2eof:A

[Back]