GPSRLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAKRSCRRRL
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pfc:L | 70 | 70 | 1.0000 | 1.0000 | 1.0000 | 6.22e-47 | 8j49:A, 8pfc:B, 8pfc:D, 8pfc:F, 8pfc:H, 8pfc:J, 8pfc:N, 8pfc:P |
2 | 1ul4:A | 81 | 67 | 0.7286 | 0.6296 | 0.7612 | 6.89e-34 | |
3 | 1wj0:A | 58 | 55 | 0.5000 | 0.6034 | 0.6364 | 1.87e-23 | |
4 | 8j4b:D | 65 | 63 | 0.5000 | 0.5385 | 0.5556 | 2.39e-23 | 8j4b:B |
5 | 1ul5:A | 86 | 65 | 0.5000 | 0.4070 | 0.5385 | 2.29e-20 | |
6 | 3qbe:A | 352 | 42 | 0.1857 | 0.0369 | 0.3095 | 5.5 | 3qbd:A, 3qbd:B |
7 | 7ly7:B | 329 | 52 | 0.2000 | 0.0426 | 0.2692 | 5.5 | 7ly4:A, 7ly4:D, 7ly5:B, 7ly6:A |
8 | 4b21:A | 207 | 25 | 0.1429 | 0.0483 | 0.4000 | 5.6 | 4b22:A, 4b23:A, 4b24:A, 4hsb:A |
9 | 4e6x:C | 305 | 25 | 0.1429 | 0.0328 | 0.4000 | 7.7 | 4e6x:B |
10 | 7mdf:A | 453 | 25 | 0.1429 | 0.0221 | 0.4000 | 7.9 | 4e6w:A, 4e6w:B, 4e6w:C, 7mdc:A |
11 | 2ct2:A | 88 | 44 | 0.1714 | 0.1364 | 0.2727 | 8.8 | 5fey:A, 5fey:B |