GPMEIIRSNFKINLHKVYQAIEEADFFAIDGEFSGISDSGFDTPEERYQKLKKHSMDFLLFQFGLCAFKYDHTDSKHVTK
SFNFYVFPKPFSRSSPDVKFVCQSSSIDFLASQGFDFNKVFCSGIPYLNQEEERQLREQFDEYTKEQEELNDAVGFSRVI
HAIANSGKLVVGHNMLLDVMHTIHQFYCPLPADLNEFKEMAICVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETP
FDPPKVESAEGFPSYDQLHEAGYDAYITGLCFISMANYLGSSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHV
LHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNTSKYAESYRIQTYA
The query sequence (length=383) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3d45:A | 383 | 383 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2a1r:A, 2a1r:B |
2 | 3d45:B | 373 | 391 | 0.9478 | 0.9732 | 0.9284 | 0.0 | 3ctr:A |
3 | 2rok:A | 100 | 74 | 0.1932 | 0.7400 | 1.0000 | 2.09e-48 | |
4 | 2p51:A | 255 | 299 | 0.1645 | 0.2471 | 0.2107 | 0.23 | 3g0z:A, 3g10:A |
5 | 2n82:B | 104 | 40 | 0.0418 | 0.1538 | 0.4000 | 1.4 | 2err:A, 7vrl:B |
6 | 4gmj:B | 264 | 298 | 0.1567 | 0.2273 | 0.2013 | 2.3 | 7ax1:B, 4gmj:D, 4gmj:F |
7 | 2l41:A | 77 | 42 | 0.0313 | 0.1558 | 0.2857 | 3.1 | 2xnr:A |
8 | 8esl:A | 309 | 67 | 0.0418 | 0.0518 | 0.2388 | 4.5 | 8esl:B, 8esl:C, 8esl:D |
9 | 2rqc:A | 115 | 64 | 0.0470 | 0.1565 | 0.2812 | 4.6 | |
10 | 3wqo:A | 271 | 43 | 0.0366 | 0.0517 | 0.3256 | 9.7 | 3wqo:B |