GPLGSPEPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQ
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8im5:A | 66 | 66 | 1.0000 | 1.0000 | 1.0000 | 9.83e-44 | 3b0a:E |
2 | 7yui:B | 232 | 55 | 0.7879 | 0.2241 | 0.9455 | 1.15e-32 | 3b08:K, 3b08:B, 3b08:E, 3b08:H, 3b0a:B |
3 | 2crc:A | 52 | 40 | 0.5606 | 0.7115 | 0.9250 | 1.44e-23 | |
4 | 1nj3:A | 31 | 20 | 0.1667 | 0.3548 | 0.5500 | 0.028 | 1q5w:A |
5 | 3a9j:C | 32 | 20 | 0.1515 | 0.3125 | 0.5000 | 0.060 | 9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C |
6 | 7mo1:B | 34 | 24 | 0.1515 | 0.2941 | 0.4167 | 0.67 | |
7 | 2k1p:A | 33 | 20 | 0.1364 | 0.2727 | 0.4500 | 0.71 | |
8 | 7odf:A | 703 | 20 | 0.1364 | 0.0128 | 0.4500 | 1.4 | |
9 | 3kyd:B | 477 | 20 | 0.1364 | 0.0189 | 0.4500 | 1.4 | |
10 | 3kyc:B | 548 | 20 | 0.1364 | 0.0164 | 0.4500 | 1.8 | 6cwz:D, 6xog:B, 6xoh:B, 1y8q:B, 1y8q:D, 1y8r:B, 1y8r:E |
11 | 6cwy:D | 487 | 20 | 0.1364 | 0.0185 | 0.4500 | 2.2 | |
12 | 7dve:A | 498 | 19 | 0.1515 | 0.0201 | 0.5263 | 4.1 | |
13 | 2p0j:A | 203 | 34 | 0.1667 | 0.0542 | 0.3235 | 4.3 | 2p0j:B, 1vrr:A, 1vrr:B |
14 | 2cr8:A | 53 | 29 | 0.1515 | 0.1887 | 0.3448 | 4.4 | |
15 | 7qbu:A | 418 | 38 | 0.2121 | 0.0335 | 0.3684 | 5.2 | 7qbs:A, 7qbt:A, 7qbt:B, 7qbt:C, 7qbt:D, 7qbu:B, 7qbv:A, 7qbv:B, 7qbv:C, 7qbv:D |
16 | 3vmw:A | 324 | 42 | 0.1818 | 0.0370 | 0.2857 | 5.7 | |
17 | 7ooc:A | 249 | 21 | 0.1364 | 0.0361 | 0.4286 | 8.8 | 7p6z:A, 7pah:A, 7pai:A, 7paj:A, 7pak:A, 7pal:A, 7pam:A, 7pan:A, 7pao:A, 7paq:A, 7par:A, 7pas:A, 7ph9:A, 7pha:A, 7phb:A, 7phc:A, 7pi8:A, 7pi9:A, 7pia:A, 7pib:A, 7pic:A, 7pio:A, 7pip:A, 7piq:A, 7pir:A, 7pis:A, 7pit:A |
18 | 4fk9:A | 314 | 20 | 0.1212 | 0.0255 | 0.4000 | 9.8 | |
19 | 4ipi:A | 351 | 22 | 0.1061 | 0.0199 | 0.3182 | 9.9 | 4ipj:A, 6ppw:A, 6ppy:A, 6ppz:A, 2wqp:A, 1xuu:A, 1xuz:A |