GPLGSPEFDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLS
The query sequence (length=110) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
4x8y:A |
112 |
106 |
0.9636 |
0.9464 |
1.0000 |
8.76e-76 |
4x8y:B |
| 2 |
6nzx:A |
76 |
55 |
0.1818 |
0.2632 |
0.3636 |
0.019 |
|
| 3 |
6vz6:A |
77 |
31 |
0.1091 |
0.1558 |
0.3871 |
0.29 |
|
| 4 |
7mpt:A |
206 |
49 |
0.1364 |
0.0728 |
0.3061 |
0.37 |
7mpt:B, 7mpu:B |
| 5 |
1cxy:A |
81 |
38 |
0.1273 |
0.1728 |
0.3684 |
0.56 |
|
| 6 |
4yd9:A |
1656 |
71 |
0.1818 |
0.0121 |
0.2817 |
1.8 |
4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b |
| 7 |
3dqy:A |
106 |
29 |
0.0818 |
0.0849 |
0.3103 |
2.6 |
4emj:B |
| 8 |
8oz6:B |
473 |
92 |
0.2000 |
0.0465 |
0.2391 |
3.9 |
8ffi:B, 8ffi:F, 8ffi:L, 8ffi:N, 8i87:F, 8i87:T, 8i87:B, 8i87:D, 8i88:B, 8j7s:A, 8j7s:E, 8j7s:I, 8j7s:M, 8jr8:A, 8jr8:C, 8oz6:D, 8oz6:F, 8oz6:H, 8ozd:B, 8ozd:D, 8oze:F, 8oze:H, 8ozf:B, 8ozf:E, 8ozf:G, 8ozf:M, 8ozg:B, 8ozg:E, 8ozg:G, 8ozg:M, 8ozi:B, 8ozi:D, 8ozi:F, 8ozi:H, 8sp0:B, 8sp0:F, 8sp3:B, 8sp3:F, 8spo:B, 8spo:F, 8spo:L, 8spo:N, 8squ:B |
| 9 |
8agd:A |
1111 |
36 |
0.1364 |
0.0135 |
0.4167 |
4.1 |
8acq:A, 8acq:C, 8acq:B, 8ae1:A, 8ae1:B, 8ae1:C, 8agd:C, 8agd:B, 7zgy:A, 7zgy:C, 7zgy:B |
| 10 |
7mpo:F |
207 |
48 |
0.1273 |
0.0676 |
0.2917 |
5.4 |
7mpl:A, 7mpl:E, 7mpl:C, 7mpl:I, 7mpl:G, 7mpl:K, 7mpl:O, 7mpl:M, 7mpm:A, 7mpm:E, 7mpm:C, 7mpm:I, 7mpm:G, 7mpm:K, 7mpm:O, 7mpm:M, 7mpn:A, 7mpn:C, 7mpn:E, 7mpn:G, 7mpn:I, 7mpn:K, 7mpn:M, 7mpn:O, 7mpo:A, 7mpo:B, 7mpo:C, 7mpo:D, 7mpo:E, 7mpo:G, 7mpo:H, 7mpp:A, 7mpp:E, 7mpp:G, 7mpp:C, 7mpp:K, 7mpp:I, 7mpp:M, 7mpp:O, 7mpq:G, 7mpq:K, 7mpq:A, 7mpq:E, 7mpq:C, 7mpq:I, 7mpq:O, 7mpq:M, 7mqb:A, 7mqb:C, 7mqb:E, 7mqb:G, 7mqb:I, 7mqb:K, 7mqb:M, 7mqb:O, 7mqc:A, 7mqc:C, 7mqc:E, 7mqc:G, 7mqc:I, 7mqc:K, 7mqc:M, 7mqc:O, 7mqd:A, 7mqd:C, 7mqd:E, 7mqd:G, 7mqd:I, 7mqd:K, 7mqd:M, 7mqd:O, 7mqe:A, 7mqe:C, 7mqe:E, 7mqe:G, 7mqe:I, 7mqe:K, 7mqe:M, 7mqe:O, 7mqf:A, 7mqf:C, 7mqf:E, 7mqf:G, 7mqf:I, 7mqf:K, 7mqf:M, 7mqf:O, 7mqg:A, 7mqg:C, 7mqg:E, 7mqg:G, 7mqg:I, 7mqg:K, 7mqg:M, 7mqg:O, 7mqh:A, 7mqh:C, 7mqh:E, 7mqh:G, 7mqh:I, 7mqh:K, 7mqh:M, 7mqh:O, 7mqi:A, 7mqi:C, 7mqi:E, 7mqi:G, 7mqi:I, 7mqi:K, 7mqi:M, 7mqi:O |
| 11 |
5zo4:A |
207 |
45 |
0.1182 |
0.0628 |
0.2889 |
6.6 |
5zo4:B, 5zo5:A, 5zo5:B |
| 12 |
7w1m:E |
1226 |
30 |
0.1000 |
0.0090 |
0.3667 |
7.1 |
6wg3:E, 6wge:E |
| 13 |
4b98:A |
441 |
23 |
0.1000 |
0.0249 |
0.4783 |
7.9 |
4b98:B, 4b98:C, 4b98:D, 4b9b:A, 4b9b:B, 4b9b:C, 4b9b:D, 4b9b:E, 4b9b:F, 4b9b:G, 4b9b:H, 4bq0:A, 4bq0:B, 4bq0:C, 4bq0:D |
| 14 |
2azq:A |
309 |
38 |
0.1273 |
0.0453 |
0.3684 |
9.5 |
|
umich.edu