Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
GPLDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1j2x:A 70 70 1.0000 1.0000 1.0000 7.25e-47 2k7l:A, 1onv:A
2 6r6u:A 458 36 0.2000 0.0306 0.3889 0.053 6r6u:B
3 8tpt:B 571 35 0.2000 0.0245 0.4000 0.60
4 7yh5:B 177 50 0.2143 0.0847 0.3000 2.1 7yh5:A, 7yh5:C, 7yh5:E, 7yh5:F
5 3zyv:B 1262 33 0.2000 0.0111 0.4242 2.1 3zyv:A, 3zyv:C, 3zyv:D
6 4v6w:AG 231 17 0.1286 0.0390 0.5294 2.9 6xu6:AG, 6xu7:AG, 6xu8:AG
7 8fhw:A 432 29 0.1714 0.0278 0.4138 3.4 8fhw:B, 8fhw:C, 8fhw:D
8 8c41:A 720 32 0.1857 0.0181 0.4062 3.4 8c41:B
9 1z16:A 344 35 0.1571 0.0320 0.3143 4.2 1z17:A, 1z18:A
10 3tz6:A 342 52 0.1857 0.0380 0.2500 4.4 3vos:A
11 5b2o:A 1455 44 0.2143 0.0103 0.3409 5.2 5b2p:A, 5b2q:A
12 2nto:A 201 34 0.1714 0.0597 0.3529 6.3 2pvq:A
13 4dno:A 297 54 0.2143 0.0505 0.2778 7.6 4dnf:A, 4dnf:B, 4dnf:C, 4dnf:D, 4dno:B, 4dno:C, 4dno:D, 4ehb:A, 4ehb:B, 4ehb:C, 4ehb:D, 4eus:B, 4eus:D, 5hk9:A, 5hk9:B, 5hk9:D, 5hka:A, 5hka:B, 5hka:C, 5hka:D, 5hkb:A, 5hkb:B, 5hkb:C, 5hkb:D, 5jyc:A, 5jyc:B, 5jyc:C, 5jyc:D, 5tnd:C, 5tnd:D, 5tnd:A, 5tnd:B, 5tne:A, 5tne:C, 5tnf:A, 5tnf:B, 5tnf:C, 5tnf:D, 5tng:A, 5tng:B, 5tng:C, 5tng:D, 5tnh:C, 5tnh:D, 5tnh:A, 5tnh:B, 5tni:A, 5tni:B, 5tni:C, 5tni:D, 5tnj:A, 5tnj:B, 5tnj:C, 5tnj:D, 5tnk:A, 5tnk:B, 5tnk:C, 5tnk:D, 5tnl:A, 5tnl:B, 5tnl:C, 5tnl:D, 5tnm:A, 5tnm:B, 5tnm:C, 5tnm:D, 5tnn:A, 5tnn:B, 5tnn:C, 5tnn:D, 5tnp:A, 5tnp:B, 5tnp:C, 5tnp:D, 5tnq:C, 5tnq:D, 5tnq:A, 5tnq:B, 5tnr:C, 5tnr:D, 5tnr:A, 5tnr:B, 5tns:D, 4yx9:A, 4yx9:B, 4yx9:C, 4yx9:D
14 8e9h:D 407 23 0.1429 0.0246 0.4348 8.5 8e9g:D
15 7f1m:A 394 30 0.1429 0.0254 0.3333 8.9 7f1m:B, 5f5o:A, 5f5o:C, 5f5o:E, 5xsq:A, 5xsq:C, 5xsq:E

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218