GPHMLDNFMKQLLKLEESLNKLELEQKVTN
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5jge:D | 30 | 30 | 1.0000 | 1.0000 | 1.0000 | 3.15e-15 | 5jge:E |
2 | 4xai:A | 565 | 21 | 0.2667 | 0.0142 | 0.3810 | 2.4 | 4xai:B |
3 | 7u4o:A | 150 | 14 | 0.3333 | 0.0667 | 0.7143 | 4.2 | 6mc1:A, 6mc1:B, 6mc1:C, 6mc1:D, 6mc1:E, 6mc1:F, 7u4o:F, 7u4o:B, 7u4o:D, 7u4o:C, 7u4o:E, 7u4r:A, 7u4r:B, 7u4r:C, 7u4r:D, 7u4r:E, 7u4r:F, 7umu:A, 7umu:B, 7umu:C, 7umu:D, 7umu:E, 7umu:F, 7umv:A, 7un0:A, 7un0:B, 7un0:C, 7un0:D, 7un0:E, 7un0:F, 7un4:A, 7un4:B, 7un4:C, 7un4:D, 7un4:E, 7un4:F |
4 | 4izc:B | 266 | 18 | 0.2667 | 0.0301 | 0.4444 | 8.1 | 4izc:A, 4izd:A, 4izd:B |