BioLiP

>protein
GNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDP
SSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPL
TVGSI

The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8r5n:A	165	165	1.0000	1.0000	1.0000	1.29e-124	8r5n:B, 8r6a:A, 8r6a:B, 8r6b:A
2	9bkr:A	74	67	0.1455	0.3243	0.3582	1.26e-08	9bks:A, 8tre:A, 7uw7:A
3	9bkr:A	74	71	0.1455	0.3243	0.3380	4.59e-06	9bks:A, 8tre:A, 7uw7:A
4	2rsf:A	110	65	0.1091	0.1636	0.2769	0.60
5	5uwa:A	185	54	0.1030	0.0919	0.3148	0.81	5uwa:B
6	4qpl:A	153	65	0.1091	0.1176	0.2769	2.1	4qpl:C, 3v3l:A, 3v3l:B
7	3he3:A	366	56	0.0970	0.0437	0.2857	2.4	3hdq:A, 3hdq:B, 3hdq:C, 3hdq:D, 3hdq:E, 3hdq:F, 3hdq:G, 3hdq:H, 3hdq:I, 3hdq:J, 3hdy:A, 3hdy:B, 3hdy:C, 3hdy:D, 3hdy:E, 3hdy:F, 3hdy:G, 3hdy:H, 3hdy:I, 3hdy:J, 3he3:B, 3he3:C, 3he3:D, 3he3:E, 3he3:F, 3he3:G, 3he3:H, 3he3:I, 3he3:J, 3mj4:A, 3mj4:B, 3mj4:C, 3mj4:D, 3mj4:E, 3mj4:F, 3mj4:G, 3mj4:H, 3mj4:I, 3mj4:J
8	8tl6:B	353	99	0.1394	0.0652	0.2323	8.1
9	8g7w:B	1059	62	0.1152	0.0179	0.3065	9.0	8g7w:A
10	7aor:z	1071	89	0.1394	0.0215	0.2584	9.5
11	3bw2:A	347	37	0.0727	0.0346	0.3243	9.8	3bw3:A, 3bw4:A

[Back]