BioLiP

>protein
GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNV
QVVLQQTYGSTLKVT

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6c8c:A	119	94	0.9579	0.7647	0.9681	4.00e-63	6c8c:B, 4fjo:A, 4gk5:E, 2lsi:A, 2lsj:A, 2lsk:A, 2n1g:A
2	7kii:A	103	23	0.0947	0.0874	0.3913	0.16	7kij:C, 7kij:A
3	1cjy:A	633	69	0.1474	0.0221	0.2029	0.82	1bci:A, 1cjy:B, 1rlw:A
4	1cjy:A	633	30	0.1368	0.0205	0.4333	5.2	1bci:A, 1cjy:B, 1rlw:A
5	6fb3:A	1836	44	0.1474	0.0076	0.3182	1.6	6fb3:B, 6fb3:C, 6fb3:D, 6ska:A, 6ske:A, 6ske:C
6	4e6n:A	407	63	0.1895	0.0442	0.2857	2.2	4e6n:C, 3ty5:A, 3ty5:B, 3ty9:A, 3ty9:B, 3ty9:C, 3ty9:D
7	6zaz:A	555	48	0.1789	0.0306	0.3542	3.0	8aa0:B, 8aa0:J, 8aa1:B, 8aa1:J, 8aa2:B, 8aa2:J, 8aa3:B, 8aa3:J, 5t3r:A, 5t4y:A, 5t4y:B, 6z8i:A, 6z9a:A
8	5x7o:A	1247	32	0.1474	0.0112	0.4375	5.9	5x7o:B, 5x7p:B, 5x7p:A, 5x7q:A, 5x7q:B, 5x7r:A, 5x7r:B, 5x7s:A, 5x7s:B
9	8fru:k	76	43	0.1368	0.1711	0.3023	7.3	8br8:Ll, 8brm:Ll, 8bsi:Ll, 8bsj:Ll, 8btd:Ll, 8btr:Ll, 7pwg:k, 7pwo:k2
10	7zol:B	1702	57	0.1895	0.0106	0.3158	8.0	7zoq:B
11	1coz:A	126	68	0.2316	0.1746	0.3235	8.2	1coz:B, 1n1d:A, 1n1d:B, 1n1d:C, 1n1d:D

[Back]