GKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVL
The query sequence (length=90) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2kzu:A |
94 |
90 |
1.0000 |
0.9574 |
1.0000 |
1.34e-62 |
5grq:B, 5grq:A, 5y18:A |
2 |
5mun:A |
182 |
26 |
0.1222 |
0.0604 |
0.4231 |
1.2 |
|
3 |
5k3i:A |
661 |
65 |
0.2111 |
0.0287 |
0.2923 |
2.7 |
5k3i:B, 5k3i:C, 5k3i:D, 5k3i:E, 5k3i:F, 5k3i:G, 5k3i:H |
4 |
6qfb:C |
1011 |
22 |
0.1111 |
0.0099 |
0.4545 |
6.1 |
|
5 |
8g1e:A |
1037 |
22 |
0.1111 |
0.0096 |
0.4545 |
6.1 |
8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D |
6 |
6a6e:A |
422 |
47 |
0.1556 |
0.0332 |
0.2979 |
6.3 |
6a6e:B, 6a6e:C, 6a6e:D, 6a6g:A, 6a6g:B |
7 |
7yi8:B |
223 |
29 |
0.1333 |
0.0538 |
0.4138 |
8.2 |
7f4p:A, 7f4q:A, 7f4t:A, 7f4t:E, 7f4t:H, 7f4t:K, 7yi9:B |
8 |
7f4m:D |
216 |
29 |
0.1333 |
0.0556 |
0.4138 |
9.0 |
7f4l:C, 7f4m:C, 7f4n:C, 7f4n:D |