GKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLG
NSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERN
EAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1amf:A | 231 | 231 | 1.0000 | 1.0000 | 1.0000 | 4.44e-170 | 3axf:A, 3axf:B, 3axf:C, 3r26:A, 1wod:A, 4xxu:A, 4xxu:B |
2 | 8k8l:A | 231 | 231 | 0.8571 | 0.8571 | 0.8571 | 3.03e-146 | |
3 | 2h5y:B | 233 | 232 | 0.5195 | 0.5150 | 0.5172 | 1.52e-72 | 3gzg:A, 3gzg:B, 3gzg:C, 2h5y:A, 2h5y:C |
4 | 4rxl:A | 229 | 226 | 0.4156 | 0.4192 | 0.4248 | 1.92e-59 | |
5 | 4kd5:C | 229 | 232 | 0.3680 | 0.3712 | 0.3664 | 3.79e-39 | |
6 | 7tav:B | 229 | 229 | 0.3463 | 0.3493 | 0.3493 | 9.80e-33 | 7tav:C, 7tav:F |
7 | 7t5a:A | 230 | 235 | 0.2944 | 0.2957 | 0.2894 | 1.49e-23 | 7t50:A, 7t50:B, 7t51:A, 7t51:B, 7t5a:B |
8 | 1atg:A | 231 | 236 | 0.2554 | 0.2554 | 0.2500 | 7.65e-10 | |
9 | 3e13:X | 317 | 53 | 0.0736 | 0.0536 | 0.3208 | 0.85 | 1y4t:A, 1y4t:D |
10 | 1ve5:A | 308 | 66 | 0.1082 | 0.0812 | 0.3788 | 1.2 | 1ve5:B |
11 | 4bfe:A | 188 | 81 | 0.0996 | 0.1223 | 0.2840 | 4.0 | 4bfe:B, 4bfe:C |