GKIILFEDVEFGGKKLELETSVSDLNVHGFNDIVSSIIVESGTWFVFDDEGFSGPSYKLTPGKYPNPGSWGGNDDELSSV
KQQ
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bv2:A | 83 | 83 | 1.0000 | 1.0000 | 1.0000 | 2.20e-55 | 2bv2:B |
2 | 4iau:A | 161 | 79 | 0.3253 | 0.1677 | 0.3418 | 1.00e-10 | |
3 | 2k1w:A | 85 | 84 | 0.3735 | 0.3647 | 0.3690 | 6.93e-09 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
4 | 1hdf:A | 100 | 82 | 0.3012 | 0.2500 | 0.3049 | 0.001 | 1hdf:B |
5 | 1hdf:A | 100 | 42 | 0.2048 | 0.1700 | 0.4048 | 0.011 | 1hdf:B |
6 | 5ht7:A | 82 | 72 | 0.2530 | 0.2561 | 0.2917 | 0.005 | 5ht7:B, 5ht7:C |
7 | 3hzb:D | 90 | 43 | 0.2048 | 0.1889 | 0.3953 | 2.3 | 3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H |
8 | 3ayx:A | 595 | 34 | 0.1687 | 0.0235 | 0.4118 | 3.8 | 3ayx:C, 3ayz:A, 3ayz:C, 5y34:A, 5y34:C |
9 | 1kib:A | 89 | 22 | 0.1084 | 0.1011 | 0.4091 | 4.1 | 1f1f:A, 1kib:B, 1kib:C, 1kib:D, 1kib:E, 1kib:F, 1kib:G, 1kib:H |