GKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKND
DAKNSIDPSTIKQIQIVVK
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1yn4:A | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 2.73e-68 | |
2 | 4hnd:A | 353 | 79 | 0.2121 | 0.0595 | 0.2658 | 0.90 | 4hnd:B, 4hne:A, 4hne:B |
3 | 8q3v:B | 70 | 31 | 0.1111 | 0.1571 | 0.3548 | 1.9 | 8q3v:R, 8q3v:b, 8q54:B, 8q54:b, 8q54:R |
4 | 4ttv:A | 403 | 59 | 0.2020 | 0.0496 | 0.3390 | 2.6 | 4hwt:A, 4hwt:B, 4p3n:A, 4p3n:B, 4p3n:C, 4p3n:D, 4ttv:B, 4ttv:C, 4ttv:D |
5 | 4h5f:A | 240 | 29 | 0.1313 | 0.0542 | 0.4483 | 5.7 | 4h5f:B, 4h5f:C, 4h5f:D, 4h5g:A, 4h5g:B |
6 | 1k63:A | 295 | 31 | 0.1111 | 0.0373 | 0.3548 | 7.8 | 2bfn:A, 1d07:A, 1g42:A, 1g4h:A, 1g5f:A, 4h77:A, 4h7d:A, 4h7e:A, 4h7f:A, 4h7h:A, 4h7i:A, 4h7j:A, 4h7k:A, 1iz7:A, 1iz8:A, 1k6e:A |
7 | 7nf6:A | 623 | 77 | 0.2222 | 0.0353 | 0.2857 | 8.6 | 7nf7:A, 7nf8:A |
8 | 3tqx:A | 396 | 67 | 0.1818 | 0.0455 | 0.2687 | 9.9 | 3tqx:B |