BioLiP

>protein
GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEELQQENLQLKKQLE

The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6gpz:A	63	62	1.0000	0.9841	1.0000	1.45e-38	6gp7:B, 6gpz:B
2	6gqn:B	62	55	0.4677	0.4677	0.5273	4.52e-13	6gqn:A
3	8e2c:A	65	62	0.5323	0.5077	0.5323	5.24e-13
4	3uw2:A	458	31	0.1935	0.0262	0.3871	0.50
5	2y5b:E	325	49	0.2742	0.0523	0.3469	1.1	3i3t:A, 3i3t:C, 3i3t:E, 3i3t:G, 3mtn:A, 3mtn:C, 2y5b:A
6	2j22:A	137	28	0.1935	0.0876	0.4286	1.9
7	4im0:A	619	30	0.2097	0.0210	0.4333	2.2	6bny:A, 6bod:A, 6boe:A, 6cq0:A, 6cq4:A, 6cq5:A, 4im2:A, 4im3:A, 6nt9:A, 6nt9:B, 5w5v:A
8	6o8b:B	657	30	0.2097	0.0198	0.4333	2.3	4eut:A, 4eut:B, 4euu:A, 4euu:B, 4iw0:A, 4jl9:A, 4jlc:A, 6o8b:A, 6o8c:B
9	2hd5:A	315	53	0.2258	0.0444	0.2642	2.3
10	4bga:C	322	31	0.1774	0.0342	0.3548	2.9	4bg8:A, 4bg8:B, 4bg9:A, 4bga:A, 4bga:D, 4bga:B, 4bgb:A, 4bgb:B
11	8ia3:E	111	24	0.1935	0.1081	0.5000	3.7	8ia3:A, 8ia3:B, 8ia3:F
12	3c1y:A	349	29	0.1935	0.0344	0.4138	4.8	3c1y:B, 3c21:A, 3c21:B, 3c23:A, 3c23:B, 4yvz:A, 4yvz:B, 4yxj:A, 4yxj:B, 4yxm:A, 4yxm:B
13	7mqa:SC	229	19	0.1290	0.0349	0.4211	4.8	2ipx:A, 7se7:A, 7se8:A, 7se8:B, 7se9:A, 7se9:B, 7sea:A, 7seb:A, 7sec:A, 7sec:B, 7sed:A
14	3nhe:A	338	42	0.2097	0.0385	0.3095	5.3	6dgf:A, 2ibi:A, 3v6c:A, 3v6e:A, 5xu8:A, 5xve:A
15	3oja:B	534	19	0.1613	0.0187	0.5263	5.3
16	8bob:A	390	34	0.2097	0.0333	0.3824	8.1	8bob:B, 1d2f:A, 1d2f:B
17	2ood:A	463	28	0.1774	0.0238	0.3929	8.3

[Back]