GGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVWLIFGSWCVSVFFPALFATEKM
FRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFLYLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRR
NFTRFSSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKDASTKAHRGVKSVITFFLLYAIFSLSFFISVWT
SERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLR
The query sequence (length=286) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8vy9:R | 290 | 289 | 0.9860 | 0.9724 | 0.9758 | 0.0 | 9iiw:R, 9iix:R, 9ij9:R, 9ija:R, 8vy7:R, 8xql:R, 8xqn:R, 8xqo:R, 8xqp:R, 8xqr:R, 8xqs:R, 8xqt:R, 8yky:R |
2 | 7xp6:R | 283 | 286 | 0.4685 | 0.4735 | 0.4685 | 5.13e-66 | |
3 | 6lkn:A | 1064 | 89 | 0.0909 | 0.0244 | 0.2921 | 0.98 | 6lkn:E, 6lkn:I, 6lkn:M |
4 | 5lwe:B | 285 | 212 | 0.1678 | 0.1684 | 0.2264 | 0.98 | 5lwe:A |
5 | 7bsp:A | 1028 | 89 | 0.0909 | 0.0253 | 0.2921 | 1.0 | 7bsq:A, 7vsh:A |
6 | 7q6n:D | 204 | 33 | 0.0455 | 0.0637 | 0.3939 | 2.4 | 3b6i:A, 3b6i:B, 3b6j:A, 3b6j:B, 3b6k:A, 3b6k:B, 3b6m:A, 3b6m:B, 4dy4:A, 4dy4:C, 5f12:A, 5f12:B, 7q6n:A, 7q6n:B, 7q6n:C, 2r96:A, 2r96:C, 2r97:A, 2r97:C, 4yqe:A, 4yqe:B, 3zho:A, 3zho:B |
7 | 7yw4:A | 120 | 65 | 0.0804 | 0.1917 | 0.3538 | 5.3 |