GGLPSLKSSFVLSESTVPGTNETVKTFLPYGSVINYYGYVKPGQAPDGLVDGNKKAYYLYVWIPAVIAEMGVRMISPTGE
The query sequence (length=231) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2wfk:A |
255 |
245 |
1.0000 |
0.9059 |
0.9429 |
1.65e-166 |
3frl:A, 3frl:B, 2wfk:B, 2wfk:C, 2wfk:D, 2wfk:E |
2 |
6rf0:C |
275 |
52 |
0.0736 |
0.0618 |
0.3269 |
0.90 |
8cl7:A, 8cl8:A, 7q36:A, 6rex:A, 6rex:B, 6rex:C, 6rex:D, 6rex:E, 6rez:A, 6rez:B, 6rez:C, 6rez:D, 6rez:E, 6rf0:A, 6rf0:E, 6rf0:B, 6rf0:D, 6rf1:A, 6rf1:E, 6rf1:B, 6rf1:C, 6rf1:D, 6rf3:A, 6rf3:B, 6rf3:C, 6rf3:D, 6rf3:E, 6rf4:A, 6rf4:B, 6rf4:C, 6rf4:D, 6rf4:E, 6rf5:A, 6rf6:A, 6rf7:A, 6rf9:A, 6rfa:A, 6rfb:A, 6rfc:A, 6tk1:A, 6tk2:A, 6tk3:A, 6tk4:A, 6tk5:A, 6tk6:A, 6tk7:A, 3x3b:A, 3x3c:A, 4xtl:A, 4xtn:A, 4xtn:B, 4xtn:C, 4xtn:D, 4xtn:E, 4xtn:F, 4xtn:G, 4xtn:H, 4xtn:I, 4xtn:J, 4xto:A, 4xto:B, 4xto:C, 4xto:D, 4xto:E, 6xyt:A, 6xyt:B, 6xyt:C, 6xyt:D, 6xyt:E, 6yby:A, 6ybz:A, 6ybz:B, 6ybz:C, 6ybz:D, 6ybz:E, 6yc0:A, 6yc0:B, 6yc0:C, 6yc0:D, 6yc0:E, 6yc1:A, 6yc1:B, 6yc1:C, 6yc1:D, 6yc1:E, 6yc2:A, 6yc2:B, 6yc2:C, 6yc2:D, 6yc2:E, 6yc3:A, 6yc3:B, 6yc3:C, 6yc3:D, 6yc3:E, 6yc4:A, 6yc4:B, 6yc4:C, 6yc4:D, 6yc4:E, 6yt4:A, 6yt4:B, 6yt4:D, 6yt4:E, 6yt4:C |
3 |
5n6n:C |
698 |
71 |
0.0866 |
0.0287 |
0.2817 |
1.7 |
5m4a:A |
4 |
3sqg:A |
578 |
32 |
0.0563 |
0.0225 |
0.4062 |
2.2 |
3sqg:D, 3sqg:G |
5 |
3gg2:A |
431 |
24 |
0.0563 |
0.0302 |
0.5417 |
4.2 |
3gg2:D, 3gg2:B, 3gg2:C |
6 |
3ai8:B |
256 |
57 |
0.0823 |
0.0742 |
0.3333 |
4.4 |
3ai8:A, 6ay2:A, 6ay2:B, 8b4t:A, 8b5f:A, 1csb:A, 1csb:B, 1csb:D, 1csb:E, 1gmy:A, 1gmy:B, 1gmy:C, 8he9:A, 8hei:A, 8hen:A, 2ipp:A, 1sp4:A |
7 |
7nky:O |
427 |
68 |
0.0779 |
0.0422 |
0.2647 |
5.0 |
|
8 |
5cio:A |
770 |
28 |
0.0563 |
0.0169 |
0.4643 |
6.5 |
5cio:B |
9 |
8xgc:M |
379 |
68 |
0.0779 |
0.0475 |
0.2647 |
7.3 |
|
10 |
7ksf:A |
742 |
116 |
0.1385 |
0.0431 |
0.2759 |
8.8 |
|
11 |
7e8p:D |
482 |
37 |
0.0563 |
0.0270 |
0.3514 |
9.8 |
7e8p:A, 7e8p:B, 7e8p:C, 7e8q:A, 7e8q:B, 7e8q:C, 7e8q:D |