GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLQADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIK
RGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTP
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5i0v:A | 159 | 157 | 0.9936 | 0.9811 | 0.9936 | 1.08e-114 | 5i0v:B, 5i0w:A, 5i0w:B, 3lzl:A, 3lzl:B, 3lzn:A, 3lzn:B, 3lzo:A, 3lzo:B, 3lzp:A, 3lzp:B, 3lzq:A, 3lzq:B, 3lzr:A, 3lzr:B, 6wed:A, 6wed:B, 6wee:A, 6wee:B, 6wee:C, 6wee:D, 6wee:E, 6wee:F, 6wef:C, 6wef:D, 6wef:A, 6wef:B, 6wef:E, 6wef:F, 6wef:G, 6wef:H, 6wef:I, 6wef:J, 6wef:K, 6wef:L |
2 | 5i0x:B | 158 | 154 | 0.5796 | 0.5759 | 0.5909 | 4.21e-63 | 5i0x:A, 5i0y:A, 5i0y:B, 3nrq:A, 3nrq:B |
3 | 7r5e:B | 157 | 161 | 0.5350 | 0.5350 | 0.5217 | 1.04e-50 | 7r4v:B, 7r4v:A, 7r4z:A, 7r4z:B, 7r5e:A, 7r5g:A, 7r5g:B, 7r5p:A, 7r5p:B, 7r5p:C, 7r5p:D, 7r5p:E, 7r5p:F |
4 | 8t7m:B | 160 | 158 | 0.3949 | 0.3875 | 0.3924 | 2.47e-29 | 8t7l:A, 8t7l:B, 8t7m:A |
5 | 2o6d:A | 158 | 159 | 0.3503 | 0.3481 | 0.3459 | 3.64e-26 | 2o6d:B, 2o6e:A, 2o6e:B, 3pjl:A, 3pjl:B, 3pjn:A, 3pjn:B |
6 | 5gan:B | 1781 | 52 | 0.1019 | 0.0090 | 0.3077 | 0.73 | 4bgd:A, 5gao:B, 5gap:B, 5nrl:B, 5zwm:D, 5zwo:D |
7 | 2b7j:A | 158 | 37 | 0.0955 | 0.0949 | 0.4054 | 1.3 | 2b7j:C |
8 | 8b6j:E | 245 | 31 | 0.0573 | 0.0367 | 0.2903 | 2.2 | 8b6j:e, 8bqs:E, 8bqs:e, 8gym:qE, 8gym:qe, 8gym:QE, 8gym:Qe, 8gzu:qE, 8gzu:qe, 8gzu:QE, 8gzu:Qe, 7tgh:3E |
9 | 8imx:S | 513 | 32 | 0.0701 | 0.0214 | 0.3438 | 3.6 | 8imy:S |
10 | 7wld:S | 532 | 32 | 0.0701 | 0.0207 | 0.3438 | 3.9 | |
11 | 1ri1:A | 252 | 81 | 0.1401 | 0.0873 | 0.2716 | 4.8 | 2hv9:A, 1ri2:A, 1ri3:A, 1ri4:A, 1z3c:A |
12 | 1u3c:A | 485 | 72 | 0.1083 | 0.0351 | 0.2361 | 5.5 | 1u3d:A |
13 | 6qdi:A | 294 | 150 | 0.2420 | 0.1293 | 0.2533 | 5.9 | |
14 | 7aqx:B | 362 | 25 | 0.0573 | 0.0249 | 0.3600 | 9.2 | 7aqz:A, 7aqz:B, 7p56:B, 7p56:A |
15 | 6i34:B | 954 | 45 | 0.0701 | 0.0115 | 0.2444 | 9.3 | 6i33:A, 6i34:A, 6i34:C, 6i34:D, 6i35:A, 6i35:B, 6i35:C, 6i35:D |