BioLiP

>protein
GEFAQAVKEYAKAVKEYAFAVKEYAQAVKG

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7bo9:A	30	30	1.0000	1.0000	1.0000	3.15e-13	7bo9:D
2	6g6f:C	30	30	0.7333	0.7333	0.7333	2.45e-10	6g6f:A, 6g6f:B, 6g6f:F, 6g6f:G
3	6g6a:B	30	30	0.7000	0.7000	0.7000	6.70e-09	6g6b:A, 6g6c:H, 6g6c:I, 6g6c:P, 6g6c:Q, 6g6c:R, 6g6c:S, 6g6c:U, 6g6c:X
4	6g68:H	30	30	0.5667	0.5667	0.5667	9.73e-09	6g68:L, 6g68:M, 6g68:O, 6g69:I, 6g69:M
5	7bau:D	30	30	0.6000	0.6000	0.6000	2.76e-08	7bau:J, 7bau:E, 7bau:G, 7bau:I
6	4pnb:D	30	30	0.5667	0.5667	0.5667	3.02e-08
7	5ez8:E	30	30	0.7000	0.7000	0.7000	5.52e-08	5ez8:G, 5ez8:A, 7nfj:C, 7nfj:E, 4pna:B, 4pna:D, 4pna:A, 4pna:G
8	7bat:B	30	30	0.5667	0.5667	0.5667	1.75e-07	7baw:D, 7baw:F
9	7qwb:E	30	30	0.6000	0.6000	0.6000	5.79e-07	6zt1:D, 6zt1:F, 6zt1:A, 6zt1:H, 6zt1:J
10	7a1t:C	30	30	0.6000	0.6000	0.6000	5.79e-07	7a1t:E, 7bim:D, 7bim:F, 7bim:H, 7bim:M, 7bim:P, 7bim:R, 7bim:j, 7bim:U, 7bim:W, 7bim:a, 7bim:c, 7bim:B, 7bim:g, 7bim:i, 7qwd:B, 7qwd:E, 7qwe:B, 7qwe:C, 7qwe:F
11	8b16:A	30	30	0.5667	0.5667	0.5667	1.61e-06	8b16:L, 8b16:H, 8b16:J, 8b16:D, 7bas:B, 7bas:A
12	7qwa:C	30	30	0.4667	0.4667	0.4667	4.98e-06	7qwa:D
13	6eiz:A	30	30	0.5000	0.5000	0.5000	8.34e-06	6eiz:C, 6eiz:E, 4pn9:C, 4pn9:E
14	5ez9:F	30	30	0.5000	0.5000	0.5000	4.33e-05	5ez9:B, 5ezc:F, 5ezc:B, 7nfn:C, 7nfn:G, 7nfn:I, 7nfn:M
15	7r3a:A	411	18	0.3000	0.0219	0.5000	6.4	7r3a:B, 7r3a:C, 7r3a:D, 7r3a:E, 7r3a:F, 7r3a:G, 7r3a:H
16	7p8n:B	613	24	0.3667	0.0179	0.4583	6.6	7p5h:B, 7p5h:E, 7p5h:b, 7p5h:e, 7p8n:b, 7p91:b, 7p91:B, 7p92:B

[Back]