GEATKRVEDQFKAKVNQTLSSTDPPVWHGRRK
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8glv:Ny | 32 | 32 | 1.0000 | 1.0000 | 1.0000 | 1.27e-18 | |
2 | 6wkd:A | 280 | 28 | 0.3750 | 0.0429 | 0.4286 | 0.11 | 6wkf:A, 6wkh:A |
3 | 6wkj:A | 251 | 28 | 0.3750 | 0.0478 | 0.4286 | 0.15 | |
4 | 7o56:A | 114 | 20 | 0.2500 | 0.0702 | 0.4000 | 5.7 | 8jkl:C, 8jkl:D, 8jkl:G, 8jkl:H, 8jkn:C, 8jkn:D, 8jkn:G, 8jkn:H, 8jko:C, 8jko:D, 8jko:G, 8jko:H, 8jkq:D, 8jkq:G, 8jkq:F, 8jkq:H, 8jks:C, 8jks:D, 8jks:G, 8jks:H, 7jm4:B, 7jm4:A, 7jm4:G, 7jm4:H, 7o56:B, 7o56:C, 7ogs:A, 7ogs:B, 7ogs:E, 7ogs:F, 7oot:A, 7oot:B, 7rh2:G, 7rh2:H, 7rh2:A, 7rh2:B |
5 | 6ro8:A | 413 | 27 | 0.2812 | 0.0218 | 0.3333 | 6.1 |