BioLiP

>protein
GDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETES
LKSYLEREDFFFYSLVYDPQQKTLADGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVAR
SVGTFARALDSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKD
FTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECT
ARLPEAVRKPLEAVLRYLETHPR

The query sequence (length=343) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7aoa:D	343	343	1.0000	1.0000	1.0000	0.0	7ao8:D, 7ao8:A, 7ao9:D, 7ao9:A, 7aoa:A, 5icn:A
2	5znp:B	186	97	0.0845	0.1559	0.2990	0.099	5znp:A, 5znr:A, 5znr:B
3	4a69:C	69	50	0.0496	0.2464	0.3400	0.26	4a69:D
4	5z8l:A	204	96	0.0787	0.1324	0.2812	1.2	5z8n:A, 5z8n:B, 5z8n:C
5	6c6g:A	457	55	0.0466	0.0350	0.2909	3.9	6c6g:B
6	7cce:A	159	105	0.0758	0.1635	0.2476	4.8
7	1hqf:A	314	35	0.0350	0.0382	0.3429	5.7	1d3v:A, 1d3v:B, 3e8q:A, 3e8q:B, 3e8q:C, 3e8z:A, 3e8z:B, 3e8z:C, 3e9b:A, 3e9b:B, 3e9b:C, 1hq5:A, 1hq5:B, 1hqf:B, 1hqf:C, 1hqg:A, 1hqg:B, 1hqg:C, 1hqh:A, 1hqh:B, 1hqh:C, 1hqx:A, 1hqx:B, 1hqx:C, 1p8m:A, 1p8m:B, 1p8m:C, 1p8n:A, 1p8n:B, 1p8n:C, 1p8o:A, 1p8o:B, 1p8o:C, 1p8p:A, 1p8p:B, 1p8p:C, 1p8q:A, 1p8q:B, 1p8q:C, 1p8r:A, 1p8r:B, 1p8s:A, 1p8s:B, 1p8s:C, 1r1o:A, 1r1o:B, 1r1o:C, 1rla:A, 1rla:B, 1rla:C, 2rla:A, 2rla:B, 2rla:C, 3rla:A, 3rla:B, 3rla:C, 4rla:A, 4rla:B, 4rla:C, 5rla:A, 5rla:B, 5rla:C, 1t4p:A, 1t4p:B, 1t4p:C, 1t4r:A, 1t4r:B, 1t4r:C, 1t4s:A, 1t4s:B, 1t4s:C, 1t4t:A, 1t4t:B, 1t4t:C, 1t5f:A, 1t5f:B, 1t5f:C, 1t5g:A, 1t5g:B, 1t5g:C, 1ta1:A, 1ta1:B, 1ta1:C, 1tbh:A, 1tbh:B, 1tbh:C, 1tbj:A, 1tbj:B, 1tbj:C, 1tbl:A, 1tbl:B, 1tbl:C, 1zpe:A, 1zpe:B, 1zpe:C, 1zpg:A, 1zpg:B, 1zpg:C
8	8xx9:A	620	80	0.0554	0.0306	0.2375	6.1	8xxa:A
9	1ofc:X	266	122	0.0845	0.1090	0.2377	6.2
10	2vpw:A	734	77	0.0612	0.0286	0.2727	6.7	2vpw:E, 2vpx:A, 2vpx:E, 2vpy:A, 2vpy:E, 2vpz:A, 2vpz:E
11	8w7m:5	529	149	0.0904	0.0586	0.2081	7.0
12	3k1j:A	566	94	0.0787	0.0477	0.2872	7.7	3k1j:B
13	7xyz:B	456	50	0.0554	0.0417	0.3800	9.8	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D

[Back]