BioLiP

>protein
GARALEALLTVAGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASHDGGKQALETVQRL
LPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAHGLTP
EQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGG
KQALETVQRLLPVLCQAHGLTPQQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLP
VLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQ
VVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDHLVALACLGGRP
ALDAVKKL

The query sequence (length=488) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4gjp:A	497	488	0.9939	0.9759	0.9939	0.0	4gg4:A, 4gjp:B, 4gjr:A, 6jtq:A, 6jtq:B, 6jvz:A, 6jvz:B, 6jw0:A, 6jw0:B, 6jw1:A, 6jw1:B, 6jw2:A, 6jw2:B, 6jw2:E, 6jw2:H, 6jw3:A, 6jw3:B, 6jw3:E, 6jw3:H, 6jw4:A, 6jw4:B, 6jw4:E, 6jw4:H, 6jw5:A, 6jw5:B, 6jw5:E, 6jw5:H, 6lew:A, 4osh:B, 4osh:A, 4osi:A, 4osj:A, 4osj:B, 4osk:A, 4osk:B, 4osl:A, 4osl:B, 4osm:A, 4osm:B, 4osq:A, 4osr:A, 4oss:A, 4ost:B, 4ost:A, 4osv:A, 4osw:A, 4osz:B, 4osz:A, 4ot0:A, 4ot0:B, 4ot3:B, 4ot3:A, 4oto:A, 3v6t:A
2	2ypf:A	675	492	0.8996	0.6504	0.8923	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
3	2ypf:A	675	496	0.8299	0.6000	0.8165	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
4	2ypf:A	675	428	0.7561	0.5467	0.8621	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
5	2ypf:A	675	486	0.7459	0.5393	0.7490	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
6	2ypf:A	675	411	0.5676	0.4104	0.6740	1.12e-151	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
7	3ugm:A	854	492	0.8689	0.4965	0.8618	0.0
8	3ugm:A	854	498	0.7992	0.4567	0.7831	0.0
9	3ugm:A	854	499	0.7889	0.4508	0.7715	0.0
10	3ugm:A	854	417	0.6803	0.3888	0.7962	0.0
11	3ugm:A	854	372	0.5615	0.3208	0.7366	2.02e-152
12	4cja:A	753	455	0.3443	0.2231	0.3692	2.59e-57
13	4cja:A	753	412	0.3094	0.2005	0.3665	4.37e-56
14	4cja:A	753	446	0.3279	0.2125	0.3587	1.88e-52
15	4cja:A	753	456	0.3402	0.2205	0.3640	3.91e-52
16	4cja:A	753	261	0.1803	0.1169	0.3372	6.77e-24
17	7tve:D	445	143	0.0635	0.0697	0.2168	0.52
18	8qpl:A	331	183	0.0881	0.1299	0.2350	5.3	8qpl:B
19	7w0k:A	457	79	0.0369	0.0394	0.2278	7.8	7w0z:A, 7w10:A, 7w1b:A, 7w1h:A

[Back]