GAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDLCIVYRDGNPYAVCDKCLKFYSKISEYRH
YS
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4xr8:H | 151 | 80 | 0.9634 | 0.5232 | 0.9875 | 6.05e-54 | 2ljx:A, 2ljy:A, 2ljy:B, 2ljz:A |
2 | 7uaj:B | 512 | 73 | 0.8659 | 0.1387 | 0.9726 | 1.29e-47 | 2fk4:A, 8gcr:A, 4giz:C, 4giz:D, 8jrn:D, 8jrn:B, 8jro:D, 8jro:B, 8jrp:B, 8jrp:D, 8jrq:B, 8jrq:D, 8jrr:B, 8jrr:D, 8r1f:B, 8r1g:B, 8r1g:E, 6siv:B, 6sja:B, 7uaj:A, 7uaj:C, 7uaj:D, 4xr8:F |
3 | 6sjv:A | 529 | 79 | 0.5732 | 0.0888 | 0.5949 | 1.32e-30 | 6sqc:A |
4 | 6slm:A | 539 | 79 | 0.5488 | 0.0835 | 0.5696 | 1.79e-27 | |
5 | 6smv:A | 525 | 72 | 0.2439 | 0.0381 | 0.2778 | 2.16e-06 | |
6 | 3py7:A | 500 | 41 | 0.1463 | 0.0240 | 0.2927 | 0.010 | |
7 | 4hg6:A | 747 | 17 | 0.1341 | 0.0147 | 0.6471 | 2.6 | 5eiy:A, 5ej1:A, 5ejz:A, 4p00:A, 4p02:A |
8 | 6yxx:AR | 267 | 20 | 0.1220 | 0.0375 | 0.5000 | 3.0 | 7aoi:AR, 6hiv:AR, 6hix:AR, 6yxy:AR |
9 | 8d3p:E | 100 | 58 | 0.1951 | 0.1600 | 0.2759 | 5.2 | 8d3l:F, 8d3l:E, 8d3m:F, 8d3m:E, 8d3p:F, 8d3q:F, 8d3q:E |
10 | 4rh7:A | 3005 | 36 | 0.1098 | 0.0030 | 0.2500 | 5.7 | |
11 | 6sc2:B | 3930 | 36 | 0.1098 | 0.0023 | 0.2500 | 6.5 | 6rla:A, 6rla:B, 6sc2:A |