BioLiP

>protein
GAMETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCG
NDQVSATLTVT

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5jdj:B	91	91	1.0000	1.0000	1.0000	5.95e-64	5jdj:E, 5jdj:I, 5jdj:L, 4qeg:A
2	1waa:C	93	90	0.3187	0.3118	0.3222	1.16e-08	1waa:A, 1waa:B, 1waa:D, 1waa:E, 1waa:F
3	6h4l:A	96	75	0.2637	0.2500	0.3200	7.89e-04
4	6s9f:B	300	83	0.2198	0.0667	0.2410	0.83	6s9f:A
5	3pps:A	564	31	0.1538	0.0248	0.4516	1.3	3pps:B, 3pps:C, 3pps:D
6	1dyq:A	228	47	0.1868	0.0746	0.3617	1.9	1i4g:A, 1i4h:A, 1i4h:B, 1sxt:A, 1sxt:B
7	5oyj:A	161	48	0.1538	0.0870	0.2917	2.2	5oyj:B
8	7ysw:C	213	33	0.1648	0.0704	0.4545	2.2	7ysw:E
9	2kny:A	80	20	0.0989	0.1125	0.4500	2.4	2knx:A
10	7za1:E	251	58	0.2088	0.0757	0.3276	2.6	7za1:F, 7za1:H, 7za2:E, 7za2:G, 7za3:E, 7za3:G
11	6tu9:A	267	67	0.1978	0.0674	0.2687	3.6	6tu9:B
12	3fu7:A	559	22	0.1209	0.0197	0.5000	3.6	3dkh:A, 3dkh:B, 3fu7:B, 3fu8:A, 3fu8:B, 3fu9:A, 3fu9:B, 1gw0:A, 1gw0:B, 2ih8:A, 2ih8:B, 2ih9:A, 2ih9:B, 2q9o:A, 2q9o:B, 3qpk:A, 3qpk:B
13	7ok5:A	582	68	0.2527	0.0395	0.3382	5.6	7ok5:B
14	3p6b:A	186	51	0.1538	0.0753	0.2745	6.8	3p6b:B
15	3ia8:A	162	33	0.1099	0.0617	0.3030	6.8	3ia8:B
16	1djs:A	206	20	0.1099	0.0485	0.5000	7.2	3cu1:C, 3cu1:A, 1e0o:B
17	5ijl:A	943	26	0.1209	0.0117	0.4231	7.7
18	8ppt:B	1191	26	0.1209	0.0092	0.4231	7.7	8ppu:B, 8ppv:B, 6t8h:B
19	7ysh:D	213	33	0.1648	0.0704	0.4545	8.0	1fq9:C, 1fq9:D, 7ysh:E

[Back]