BioLiP

>protein
GAMEPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCA
RNKCGPGEPAYVDEPVNMS

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8bw6:A	99	99	1.0000	1.0000	1.0000	1.53e-70
2	8oq9:A	103	85	0.3333	0.3204	0.3882	6.68e-16	8oq9:B, 8oq9:C, 8orl:A, 8orl:B, 8orl:C
3	6iaa:A	815	93	0.3131	0.0380	0.3333	5.01e-08	6iaa:B
4	6x38:A	93	86	0.2323	0.2473	0.2674	9.81e-05
5	6gvk:A	201	86	0.3030	0.1493	0.3488	1.10e-04	6gvl:A
6	4bqc:A	197	74	0.2020	0.1015	0.2703	0.037
7	5ien:A	129	73	0.1919	0.1473	0.2603	0.26	5ien:B, 5ieo:A, 5iep:A
8	5ks7:A	123	29	0.1212	0.0976	0.4138	1.1	5ks7:B
9	6zpo:b	209	52	0.1515	0.0718	0.2885	4.9	2wss:T, 6z1u:b, 6zbb:b, 6zmr:b, 6zqm:b, 6zqn:b
10	4urm:B	195	36	0.1414	0.0718	0.3889	5.2	5cph:A, 5cph:B, 5ctu:A, 5ctu:B, 5ctw:A, 5ctw:B, 5ctx:B, 5cty:B, 5d6p:A, 5d6p:B, 5d6q:B, 5d7c:A, 5d7c:B, 5d7d:A, 5d7d:B, 5d7r:A, 5d7r:B, 3g75:A, 3g75:B, 3g7b:A, 3g7b:B, 4p8o:A, 4p8o:B, 6tck:A, 6tck:B, 3ttz:A, 3ttz:B, 6ttg:A, 6ttg:B, 3u2d:A, 3u2d:B, 3u2k:A, 3u2k:B, 4urm:A, 4urm:C, 4urm:D, 4uro:A, 4uro:B, 4uro:C, 4uro:D, 5z9p:A, 5z9p:B
11	2iou:A	376	27	0.1010	0.0266	0.3704	6.3	2iou:B, 2iou:C, 2iou:D, 2iou:E, 2iou:F, 1yu0:A, 1yu4:A, 1yu4:B, 1yu4:C

[Back]