GALKPAKAIVEALLFAAGDEGLSLSQIAAVLEVSELEAKAVIEELQQDCRREERGIQLVELGGVFLLATKKEHAPYLKKL
V
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3w6k:C | 87 | 80 | 0.9877 | 0.9195 | 1.0000 | 1.01e-50 | 3w6k:B, 3w6k:E, 3w6k:F |
2 | 8jzg:B | 390 | 47 | 0.2840 | 0.0590 | 0.4894 | 0.051 | 8jzg:A, 8jzg:D, 8jzg:C |
3 | 1khw:B | 497 | 40 | 0.1975 | 0.0322 | 0.4000 | 0.27 | 1khw:A |
4 | 5a7i:A | 313 | 71 | 0.2716 | 0.0703 | 0.3099 | 0.55 | 5a7j:A, 5a7j:B, 4cml:A, 3mtc:A, 3n9v:A, 3n9v:B |
5 | 6wbo:A | 555 | 20 | 0.1358 | 0.0198 | 0.5500 | 6.7 | |
6 | 5knx:B | 176 | 82 | 0.2593 | 0.1193 | 0.2561 | 7.6 | 1g9s:A, 1g9s:B, 1g9t:A, 1g9t:B, 1grv:B, 1grv:A, 1j7j:A, 1j7j:B, 5knr:A, 5knr:B, 5kns:A, 5kns:B, 5knt:A, 5knt:B, 5knu:A, 5knu:B, 5knv:A, 5knv:B, 5knx:A |