BioLiP

>protein
GAIWQWRDDRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLA

The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	9bkr:A	74	72	1.0000	0.9730	1.0000	7.01e-50	9bks:A, 8tre:A, 7uw7:A
2	7mop:A	2445	62	0.3194	0.0094	0.3710	3.83e-10	6fyh:A, 6pfl:A, 6pfl:B, 8r7o:A, 8r7o:C, 8rd0:C, 8rd0:D, 8rd1:A, 8rd1:C, 8rd1:D, 8rd7:D, 6xz1:A
3	8r5n:A	165	58	0.3056	0.1333	0.3793	5.65e-08	8r5n:B, 8r6a:A, 8r6a:B, 8r6b:A
4	8r5n:A	165	71	0.3333	0.1455	0.3380	2.10e-06	8r5n:B, 8r6a:A, 8r6a:B, 8r6b:A
5	7kzh:A	182	70	0.2639	0.1044	0.2714	0.001	7tgq:A
6	1gpm:A	501	33	0.1667	0.0240	0.3636	3.0	1gpm:B, 1gpm:C, 1gpm:D
7	2d7i:A	536	38	0.1389	0.0187	0.2632	3.0	2d7r:A
8	3lnn:A	341	42	0.2083	0.0440	0.3571	4.3
9	6z1p:AN	96	40	0.1667	0.1250	0.3000	4.7
10	3ujk:A	298	28	0.1389	0.0336	0.3571	4.8	3nmv:B, 3ujl:B
11	7qzj:A	422	22	0.1528	0.0261	0.5000	6.1	7qzj:B
12	8wmi:A	1237	22	0.1250	0.0073	0.4091	7.7
13	8wm4:A	1331	22	0.1250	0.0068	0.4091	7.7
14	8wmc:A	1249	22	0.1250	0.0072	0.4091	7.7
15	7y9x:A	1458	22	0.1250	0.0062	0.4091	7.8	8gs2:A
16	7y9y:A	1482	22	0.1250	0.0061	0.4091	7.9	8wml:A
17	7wah:A	1473	22	0.1250	0.0061	0.4091	8.2
18	8d1v:A	1229	22	0.1250	0.0073	0.4091	8.2
19	8eex:A	1284	22	0.1250	0.0070	0.4091	8.2
20	7yn9:A	1514	22	0.1250	0.0059	0.4091	8.4
21	8eey:A	1544	22	0.1250	0.0058	0.4091	8.4	7yna:A, 7ynb:A, 7ync:A
22	7ynd:A	1567	22	0.1250	0.0057	0.4091	8.7

[Back]