BioLiP

>protein
GAFFRLKEIDQTDALRRIAKGKMAMLTEDGDQLERELDAMYEHYKERKASQDAKYRAKRARQEVDDEEWEGLSARLEEDS
SKPLIKDLSSKRARGFFSQDVFQKIPGLWEERPNIDIITAEAMTLAHQLATGEKTKADLIDEGYNKYAFKQKEGLPDWFL
EDEAKHDKPIKPITKEAAQAIKEKLRALNARPIKKVAEARARRKLRQAKKLEKLKQVKVVKATGANRGIKGRPKGVKGRY
KMVDGRMKKEMRALKRLAKKKR

The query sequence (length=262) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ia0:CS	629	262	1.0000	0.4165	1.0000	0.0	8i9w:CS, 8i9x:CS, 8i9y:CS, 8i9z:CS
2	8v87:w	280	289	0.5496	0.5143	0.4983	1.04e-77
3	7nac:w	672	304	0.5496	0.2143	0.4737	1.20e-75	7naf:w, 7r6k:w, 7r7a:w, 7r7o:A, 7r7o:B
4	8esq:w	504	227	0.4160	0.2163	0.4802	1.53e-62	8esr:w
5	6elz:w	436	147	0.3740	0.2248	0.6667	7.63e-62	6em5:w
6	7ohr:w	198	147	0.3130	0.4141	0.5578	1.41e-45
7	7u0h:w	321	172	0.3244	0.2648	0.4942	1.41e-40
8	6ylx:w	360	112	0.2176	0.1583	0.5089	8.44e-26
9	8fky:SJ	255	174	0.2366	0.2431	0.3563	1.15e-24	8fkx:SJ
10	8etc:w	420	124	0.1908	0.1190	0.4032	4.94e-20
11	8etc:w	420	49	0.0802	0.0500	0.4286	0.002
12	7ohv:w	69	68	0.1489	0.5652	0.5735	1.27e-15
13	7nad:w	328	181	0.2252	0.1799	0.3260	9.23e-09	7r72:w
14	8fkv:SJ	340	98	0.1145	0.0882	0.3061	1.86e-08	8fkp:SJ, 8fkq:SJ, 8fks:SJ, 8fkt:SJ, 8fku:SJ, 8fkw:SJ
15	7r6q:w	68	29	0.0687	0.2647	0.6207	1.91e-08
16	7r6q:w	68	25	0.0534	0.2059	0.5600	0.031
17	3ryb:A	563	36	0.0458	0.0213	0.3333	1.6	3drf:A, 3drg:A, 3drh:A, 3dri:A, 3drj:A, 3drk:A, 3rya:A
18	4p4s:B	336	36	0.0534	0.0417	0.3889	2.5	4p4s:A, 4p4t:A
19	4qyz:K	152	98	0.1031	0.1776	0.2755	3.3
20	7k3p:A	329	110	0.1145	0.0912	0.2727	5.0	7k3p:B
21	6nez:A	116	42	0.0611	0.1379	0.3810	6.8	6nez:B, 6nez:C, 6nez:D

[Back]