GAENNMVRLSRIIIDPERLEEYNAYLKEEIEVSMRLEPGVLVLYAVAEKERPNHVTILEIYADEAAYKSHIATPHFKKYK
EGTLDMVQMLELIDATPLIPGLKMK
The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3kkf:A | 105 | 105 | 1.0000 | 1.0000 | 1.0000 | 4.36e-73 | |
2 | 1tuv:A | 103 | 31 | 0.0952 | 0.0971 | 0.3226 | 0.89 | |
3 | 8eey:A | 1544 | 68 | 0.2000 | 0.0136 | 0.3088 | 2.3 | 7yna:A, 7ynb:A, 7ync:A |
4 | 7y9y:A | 1482 | 68 | 0.2000 | 0.0142 | 0.3088 | 2.4 | 8wml:A |
5 | 7tvf:B | 175 | 43 | 0.1429 | 0.0857 | 0.3488 | 2.4 | 9c1a:A, 9c1b:A, 9c1b:B, 9c1b:C, 9c1b:D, 3kko:A, 3kko:B, 3kko:P, 3kkp:A, 3kkq:A, 3pir:A, 3pit:A, 7sd0:B, 7tvf:E, 7txh:A, 7txh:D, 7upi:A, 1x1r:A, 1x1s:A |
6 | 7pub:Cj | 227 | 69 | 0.2095 | 0.0969 | 0.3188 | 3.3 | 6hiv:Cj, 6hiw:Cj, 6hiy:Cj, 7pua:Cj, 6sga:Cj, 6sgb:Cj |
7 | 8wmc:A | 1249 | 65 | 0.1905 | 0.0160 | 0.3077 | 3.6 | |
8 | 8d1v:A | 1229 | 65 | 0.1905 | 0.0163 | 0.3077 | 3.7 | |
9 | 8eex:A | 1284 | 65 | 0.1905 | 0.0156 | 0.3077 | 3.7 | |
10 | 7ynd:A | 1567 | 65 | 0.1905 | 0.0128 | 0.3077 | 3.7 | |
11 | 7y9x:A | 1458 | 65 | 0.1905 | 0.0137 | 0.3077 | 3.8 | 8gs2:A |
12 | 7yn9:A | 1514 | 65 | 0.1905 | 0.0132 | 0.3077 | 3.8 | |
13 | 7ane:ad | 694 | 16 | 0.0952 | 0.0144 | 0.6250 | 8.9 |