BioLiP

>protein
FYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSD
LGVEIVECFKQKA

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4aso:A	93	93	1.0000	1.0000	1.0000	7.30e-66	4aso:B, 4aso:D, 4aso:E, 4aso:F, 4aso:G, 4aso:H, 4aso:I, 4aso:K, 4aso:J, 4aso:L, 4aso:M, 4aso:N, 4aso:O, 4aso:P, 4ass:E, 4ass:F, 4ass:G, 4ass:H
2	4pyd:C	154	43	0.1613	0.0974	0.3488	0.17	4pya:A, 4pyd:A, 4pyd:B, 4pyd:E, 4pyd:D, 4pyd:F
3	2iop:A	618	82	0.1720	0.0259	0.1951	1.5	2iop:B, 2iop:C, 2iop:D, 2ior:A, 1y4s:A, 1y4s:B
4	4dzh:A	439	80	0.2366	0.0501	0.2750	3.8
5	8bha:A	336	42	0.1290	0.0357	0.2857	4.5	8bgi:A, 8bgi:E, 8bgi:B, 8bgi:C, 8bgi:D, 8bha:E, 8bha:B, 8bha:C, 8bha:D, 8bhb:A, 8bhb:E, 8bhb:B, 8bhb:C, 8bhb:D, 8bhg:A, 8bhg:E, 8bhg:C, 8bhg:D, 8bhi:A, 8bhi:E, 8bhi:B, 8bhi:C, 8bhi:D, 8bhk:A, 8bhk:B, 8bhk:C, 8bhk:D, 8bhk:E, 8bhm:A, 8bhm:E, 8bhm:B, 8bhm:C, 8bhm:D, 8bho:A, 8bho:E, 8bho:B, 8bho:C, 8bho:D, 8bhq:A, 8bhq:E, 8bhq:B, 8bhq:C, 8bhq:D, 8bhr:A, 8bhr:E, 8bhr:B, 8bhr:C, 8bhr:D, 8bhs:A, 8bhs:E, 8bhs:B, 8bhs:C, 8bhs:D
6	6l4t:12	173	24	0.1183	0.0636	0.4583	6.7	6l4u:12
7	2azn:A	219	21	0.1075	0.0457	0.4762	7.4	2azn:B, 2azn:C, 2azn:D, 2azn:E, 2azn:F
8	3lkv:A	296	71	0.2043	0.0642	0.2676	8.8

[Back]