FWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFNLENQRLYVADLRLVSQFGSPRISIDTPMICA
RDSPSCNSTHATVLIPFFGGVLTGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRGDRNDVLVLTFIYYGKTVPMLI
SLVC
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8rkg:A | 170 | 168 | 1.0000 | 0.9647 | 0.9762 | 1.05e-118 | 8rkg:B, 8rkg:C, 8rkg:D, 8rkg:E, 8rkg:F, 8rkg:G, 8rkg:H |
2 | 8rke:B | 279 | 139 | 0.2622 | 0.1541 | 0.3094 | 6.46e-17 | |
3 | 8rkh:A | 219 | 138 | 0.2256 | 0.1689 | 0.2681 | 7.43e-09 | |
4 | 4g3m:A | 361 | 28 | 0.0732 | 0.0332 | 0.4286 | 0.20 | 2b3z:A, 2b3z:B, 2b3z:C, 2b3z:D, 2d5n:A, 2d5n:B, 2d5n:C, 2d5n:D, 3ex8:A, 3ex8:B, 3ex8:C, 3ex8:D, 4g3m:B, 4g3m:C, 4g3m:D |
5 | 2y65:C | 343 | 73 | 0.1524 | 0.0729 | 0.3425 | 6.8 | 2y5w:A, 2y5w:B, 2y65:D, 2y65:B, 2y65:A |
6 | 1gvf:B | 275 | 44 | 0.0854 | 0.0509 | 0.3182 | 9.7 | 1gvf:A |
7 | 8db6:B | 304 | 56 | 0.1098 | 0.0592 | 0.3214 | 9.9 | 8db6:A, 8db6:C, 8db6:D, 8db7:B, 8db7:A, 8db7:C, 8db7:D, 8db8:B, 8db8:A, 8db8:C, 8db8:D, 8db9:A, 8db9:B, 8db9:C, 8db9:D |