Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7tm3:3 68 62 1.0000 0.9118 1.0000 2.66e-40 8btk:SY, 6fti:y, 6ftj:y, 8oj0:2, 6r7q:YY, 7tut:3, 6w6l:2
2 2rak:A 382 32 0.2419 0.0393 0.4688 0.80
3 7pw9:A 1952 46 0.1935 0.0061 0.2609 1.00 7pw4:A, 7pw5:A, 7pw6:A, 7pw7:A, 7pw8:A, 6z3r:A
4 6syt:A 1896 46 0.1935 0.0063 0.2609 1.2
5 6wby:A 1250 21 0.1452 0.0072 0.4286 1.9
6 6w98:A 1312 21 0.1452 0.0069 0.4286 1.9 6wbx:A
7 8gu0:B 450 28 0.1774 0.0244 0.3929 2.3 8gu0:A
8 7pt6:8 402 41 0.2258 0.0348 0.3415 3.3 7pt6:H, 7pt7:8, 7v3v:H
9 8jze:l 250 37 0.1774 0.0440 0.2973 4.1 8jzf:l
10 6ks6:A 550 31 0.1613 0.0182 0.3226 7.5 6ks6:a, 4v81:A, 4v81:a, 4v8r:AA, 4v8r:Aa, 4v8r:BA, 4v8r:Ba, 4v94:A, 4v94:I, 4v94:a, 4v94:i, 7ylw:A, 7ylw:a, 7ylx:A, 7ylx:a, 7yly:A, 7yly:a

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218