FTGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESEENLFEIITADEVHYFLQ
AATPKERTEWIKAIQMASR
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2i5f:A | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 2.87e-72 | 2i5c:A, 2i5c:B, 2i5c:C |
| 2 | 9c1w:A | 388 | 98 | 0.2929 | 0.0747 | 0.2959 | 5.91e-08 | 8q61:A |
| 3 | 6bbp:A | 520 | 114 | 0.3333 | 0.0635 | 0.2895 | 7.07e-08 | 2a5d:A, 2a5f:A, 2a5g:A, 6bbq:A, 1e0s:A, 1fgy:A, 1fhw:A, 1fhw:B, 1fhx:A, 1fhx:B, 4fme:C, 4fme:F, 2j5x:A, 2j5x:B, 4kax:A, 4kax:B, 3n5c:A, 3n5c:B, 3pcr:B, 2r09:A, 2r09:B, 2r0d:A, 2r0d:B, 3vhx:A, 3vhx:C, 3vhx:E, 3vhx:G, 2w83:A, 2w83:B, 2w83:E, 7xrd:A, 7xrd:B, 7xrd:C, 7xrd:D |
| 4 | 6u3e:A | 397 | 114 | 0.3333 | 0.0831 | 0.2895 | 8.01e-08 | 6u3e:B, 6u3g:A, 6u3g:B |
| 5 | 6hhg:A | 386 | 98 | 0.2929 | 0.0751 | 0.2959 | 1.23e-07 | 4ejn:A, 6hhf:A, 6hhh:A, 7nh4:A, 7nh5:A, 3o96:A, 6s9x:A |
| 6 | 1u27:A | 119 | 115 | 0.3434 | 0.2857 | 0.2957 | 1.38e-06 | 1u29:A |
| 7 | 6s9w:A | 411 | 102 | 0.3030 | 0.0730 | 0.2941 | 3.27e-06 | 6buu:A, 6buu:B, 6ccy:A, 3cqu:A, 3cqw:A, 4ekk:A, 4ekk:B, 4ekl:A, 4gv1:A, 1h10:A, 6hhi:A, 6hhj:A, 3mv5:A, 3mvh:A, 6npz:A, 6npz:B, 3ocb:A, 3ocb:B, 3ow4:A, 3ow4:B, 3qkk:A, 3qkl:A, 3qkm:A, 1unq:A, 2uvm:A, 8uvy:A, 8uw2:A, 8uw7:A, 8uw9:A, 2uzs:A |
| 8 | 3tfm:A | 208 | 95 | 0.2828 | 0.1346 | 0.2947 | 4.45e-06 | |
| 9 | 7kjz:A | 102 | 99 | 0.2828 | 0.2745 | 0.2828 | 3.70e-05 | 7kjz:B |
| 10 | 1fao:A | 100 | 92 | 0.2828 | 0.2800 | 0.3043 | 8.49e-05 | |
| 11 | 4hhv:A | 103 | 102 | 0.3131 | 0.3010 | 0.3039 | 1.19e-04 | 4hhv:B |
| 12 | 5kcv:A | 353 | 99 | 0.2929 | 0.0822 | 0.2929 | 8.43e-04 | |
| 13 | 3aj4:A | 112 | 105 | 0.2727 | 0.2411 | 0.2571 | 0.47 | |
| 14 | 8t8s:B | 664 | 41 | 0.1717 | 0.0256 | 0.4146 | 2.2 | 3f6k:A, 5mrh:A, 5mri:A, 4msl:A, 4n7e:A, 5nmr:A, 4po7:A, 8t8r:A, 8t8s:A, 6x3l:A, 6x48:A, 6x4h:A |
| 15 | 5hzi:A | 476 | 33 | 0.1414 | 0.0294 | 0.4242 | 5.7 | 5djt:A, 5dju:A, 5dju:C, 5efw:A, 5hzi:B, 5hzj:A, 5hzj:B, 5hzk:B, 5hzk:D, 7pgx:AAA, 7pgy:AAA, 7pgz:AAA, 7ph0:AAA, 2v0u:A, 2v0w:A, 2v1a:A, 2v1b:A |
| 16 | 5hev:F | 210 | 45 | 0.1414 | 0.0667 | 0.3111 | 6.4 | 5hev:A, 5hev:B, 5hev:C |
| 17 | 3nyc:A | 381 | 31 | 0.1313 | 0.0341 | 0.4194 | 7.6 | 3nye:A, 3nyf:A, 6p9d:A, 6pld:A, 7rdf:A, 3sm8:A |
| 18 | 3s6p:C | 536 | 34 | 0.1313 | 0.0243 | 0.3824 | 9.5 | 3s6p:B |
| 19 | 5exe:C | 314 | 19 | 0.1010 | 0.0318 | 0.5263 | 9.7 | 5c4i:C, 5c4i:F, 5exd:C, 5exd:F, 5exd:I, 5exd:L, 5exe:F |
umich.edu