FSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVR
RLKSKGQIP
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1bh9:B | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 1.62e-62 | |
2 | 5xq3:A | 901 | 20 | 0.1124 | 0.0111 | 0.5000 | 3.9 | 5xq3:B, 5xqg:A, 5xqg:B, 5xqg:C, 5xqg:D, 5xqg:E, 5xqg:F, 5xqg:G, 5xqg:H, 5xqj:A, 5xqj:B, 5xqj:C, 5xqj:D, 5xqj:E, 5xqj:F, 5xqj:G, 5xqj:H, 5xqo:A, 5xqo:B |
3 | 7bur:B | 389 | 54 | 0.1461 | 0.0334 | 0.2407 | 5.8 | 7bur:A, 8jrd:A, 8jrd:B |
4 | 6c7n:A | 553 | 31 | 0.1124 | 0.0181 | 0.3226 | 6.8 | 6c7n:B, 6c7n:C |
5 | 5ifw:B | 702 | 52 | 0.1685 | 0.0214 | 0.2885 | 6.9 | |
6 | 1a7w:A | 68 | 67 | 0.1910 | 0.2500 | 0.2537 | 8.2 | 5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F |
7 | 6d50:B | 840 | 24 | 0.1236 | 0.0131 | 0.4583 | 9.9 | 6d50:A, 6nzg:A, 6nzg:B, 5uj6:A, 5uj6:B |
8 | 1chw:A | 389 | 43 | 0.1124 | 0.0257 | 0.2326 | 10.0 | 1bq6:A, 1cgk:A, 1cgz:A, 1chw:B, 1cml:A, 1d6h:A, 1u0w:A, 1u0w:B, 1u0w:C, 1u0w:D |