FSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKE
RDLYKEKYEKLA
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4eot:A | 92 | 91 | 0.9891 | 0.9891 | 1.0000 | 3.96e-60 | 4eot:B |
2 | 2wty:B | 97 | 92 | 0.8261 | 0.7835 | 0.8261 | 4.50e-48 | 4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A |
3 | 7x5e:E | 101 | 91 | 0.5652 | 0.5149 | 0.5714 | 1.11e-30 | 3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E |
4 | 7x5e:B | 106 | 77 | 0.2065 | 0.1792 | 0.2468 | 1.2 | 7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F |
5 | 2wt7:A | 63 | 46 | 0.1522 | 0.2222 | 0.3043 | 1.3 | 1a02:F, 1fos:E, 1fos:G, 1s9k:D |
6 | 8tri:B | 454 | 27 | 0.1413 | 0.0286 | 0.4815 | 1.6 | 7suu:A, 7suu:B, 8tri:A |
7 | 6evq:A | 70 | 27 | 0.1522 | 0.2000 | 0.5185 | 1.7 | 6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B |
8 | 8tri:C | 419 | 27 | 0.1413 | 0.0310 | 0.4815 | 1.9 | |
9 | 7yw3:A | 205 | 65 | 0.2065 | 0.0927 | 0.2923 | 4.4 | |
10 | 4kr6:B | 388 | 42 | 0.1413 | 0.0335 | 0.3095 | 4.7 | 4kr6:A, 4kr7:A, 4kr7:B, 4kr9:A, 4kr9:B |
11 | 5gnj:B | 77 | 19 | 0.1087 | 0.1299 | 0.5263 | 7.2 | 5gnj:G, 5gnj:I, 5gnj:A, 5gnj:E, 5gnj:F, 5gnj:M, 5gnj:N |