BioLiP

>protein
FPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPNDLAKDSKGRFFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLK
REAEYFQLPDLVKLLTPDE

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ocp:B	99	99	1.0000	1.0000	1.0000	2.78e-69	6m8r:A, 6m8r:F, 6ocp:C, 6ocp:D, 6ocp:E, 6ocp:F, 6ocp:G, 6ocp:H, 6ocp:K, 6ocp:L, 6ocp:M, 6ocp:N
2	6sga:FS	277	66	0.2525	0.0903	0.3788	1.07e-04	6sga:FQ, 6sga:FR, 6sga:FU, 6sgb:FQ, 6sgb:FR, 6sgb:FU
3	2i2r:L	138	70	0.2222	0.1594	0.3143	0.002	2i2r:A, 2i2r:C, 2i2r:D, 2i2r:I, 2i2r:J, 2i2r:K, 2nz0:B, 2nz0:D, 1s1g:A, 1s1g:B
4	2i2r:B	124	97	0.2727	0.2177	0.2784	0.003
5	7e8e:D	459	70	0.2323	0.0501	0.3286	0.006	7e87:B, 7e87:A, 7e87:C, 7e87:D, 7e8e:B, 1nn7:A, 7ukg:A, 7ukg:B, 7ukg:C, 7ukg:D
6	8quc:A	395	72	0.2323	0.0582	0.3194	0.011	8f1c:A, 8f1c:B, 8f1c:C, 8f1c:D, 8f1d:A, 8f1d:B, 8f1d:C, 8f1d:D, 7phi:C, 7phi:B, 7phi:D, 8quc:B, 8quc:D, 8quc:C, 8qud:A, 8qud:B, 8qud:C, 8qud:D
7	7ukh:A	203	70	0.2323	0.1133	0.3286	0.043	7ukh:B, 7ukh:C, 7ukh:D
8	1t3q:B	786	41	0.1515	0.0191	0.3659	0.40	1t3q:E
9	4iee:A	452	61	0.1717	0.0376	0.2787	0.59	5c12:A, 5c15:A, 5c2d:A, 5c2f:A, 4iei:A, 4ife:A
10	8osg:A	283	62	0.1717	0.0601	0.2742	1.8
11	8osg:F	258	88	0.2626	0.1008	0.2955	2.5
12	5juy:B	1234	73	0.2525	0.0203	0.3425	2.9	1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D
13	7yr9:A	146	44	0.1515	0.1027	0.3409	4.4	7yr9:B, 7yra:A, 7yra:B
14	4eo3:A	321	35	0.1313	0.0405	0.3714	4.6	4eo3:B
15	2xy4:A	267	49	0.1717	0.0637	0.3469	4.6	4bbp:A, 2ogw:A, 2ogw:B, 2osv:A, 2osv:B, 2prs:A, 2prs:B, 2ps0:A, 2ps0:B, 2ps9:A, 2ps9:B, 7rcj:A, 7rcj:B, 7rcj:C, 7rcj:D, 7rcj:E, 7rcj:F, 2xqv:A
16	5vx6:A	209	48	0.1313	0.0622	0.2708	5.5	5vx6:B
17	7pt6:2	629	58	0.2020	0.0318	0.3448	5.8	5bk4:2, 5bk4:A, 6eyc:2, 6f0l:A, 6f0l:2, 3ja8:2, 7p30:2, 7p30:A, 7p5z:2, 7p5z:A, 7pt6:B, 7pt7:2, 7pt7:B, 6rqc:2, 6sko:2, 5u8s:2, 7v3u:2, 7v3u:B, 7v3v:2, 7v3v:B, 5v8f:2, 8w7m:2, 7w8g:2, 7w8g:B
18	8iuf:C1	495	30	0.1313	0.0263	0.4333	6.3	8iuj:c1, 8iuj:C1
19	8xgc:2	778	58	0.2020	0.0257	0.3448	7.6	8kg6:2, 8kg8:2, 8kg9:2, 8p5e:2, 8p62:2, 8p63:2, 7pmk:2, 7pmn:2, 6ptn:i, 6ptn:2, 6pto:h, 6pto:2, 7qhs:2, 6skl:2, 6u0m:2, 7z13:2, 7z13:a
20	8osg:B	323	37	0.1111	0.0341	0.2973	9.3	8osf:A, 8osf:B, 8osf:C, 8osf:D, 8osf:E, 8osg:C, 8osg:D, 8osg:E
21	4ttb:A	189	18	0.0808	0.0423	0.4444	9.3	4ttb:B

[Back]